BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F06 (899 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 33 0.24 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) 30 2.9 SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) 28 8.9 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 33.5 bits (73), Expect = 0.24 Identities = 30/88 (34%), Positives = 38/88 (43%), Gaps = 1/88 (1%) Frame = -1 Query: 587 SAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVAVIPDLPPICLFISIAASAFLLAQ 408 S + P+SG+ P PP+ VF S S P PV P PP +F A S+ + Sbjct: 424 SVFAPSSGV--PTPVAAPPPS---VFASSSGVPTPVTAPPPAPPPSVF---APSSGVPTP 475 Query: 407 SRRPP*FVLSP-CGSQDPGAVGLPGQFA 327 PP V +P G P A P FA Sbjct: 476 VAAPPPSVFAPSSGVPTPVAAPPPSVFA 503 Score = 33.1 bits (72), Expect = 0.31 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = -1 Query: 587 SAWTPTSGLL*PNSFETIPPAERRVFLSRSHTPEPVAVIPDLPPICLFISIAASAFLLAQ 408 S + +SG+ P + PP+ VF S S P PVA P PP +F A S+ + Sbjct: 366 SVFASSSGV--PTPVKAPPPS---VFASSSGVPTPVAAPPPAPPPSVF---APSSGVPTP 417 Query: 407 SRRPP*FVLSP-CGSQDPGAVGLPGQFAA 324 PP V +P G P A P FA+ Sbjct: 418 VAAPPPSVFAPSSGVPTPVAAPPPSVFAS 446 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -1 Query: 587 SAWTPTSGLL*PNSFETIPPAER-RVFLSRSHTPEPVAVIPDLPPICLFISIAA 429 S + P+SG+ P PPA VF S P PV P PP +F +A Sbjct: 522 SVFAPSSGV--PTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSA 573 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +3 Query: 507 QEHPPLSRRYGLEGIRSQKTRRRRPGRVPS*LVIKKIPSRHHRS 638 + H P R RS+ RRRR R P + PS HHRS Sbjct: 212 RSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRS 255 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +3 Query: 228 QVGGGKVFGTLGQNDDGLFGKAGYNREIFNDDRGKLTGQAYG 353 Q G G FGT GLFG AG N G +TG +G Sbjct: 48 QTGFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFG 89 >SB_26881| Best HMM Match : Atrophin-1 (HMM E-Value=0.86) Length = 1110 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +1 Query: 340 GRPTAPGSWDPQGDSTNYGGRLDWANKNAEAAIDINRQIGGRSGMTATGSGVWDLDKNTR 519 GR T+P SWD + D + + G L + N A G SG+++ S + + Sbjct: 383 GRTTSP-SWDYRPDMSPFHGTLTSPSGNVYVATTDEFTSGHASGLSSAASSGFTSAPGSE 441 Query: 520 LSAGGMV 540 S GG + Sbjct: 442 TSDGGFI 448 >SB_42720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2391 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +3 Query: 474 DSNRLRSVGS*QEHPPLSRRYGLEGIRSQKTRRRRPGRVPS 596 D+ +LR V E PPL RYG G+ +K R R PG+ P+ Sbjct: 2322 DAIKLRRVPLKAEKPPLRGRYG--GVHRRK-RGRPPGQGPT 2359 >SB_41041| Best HMM Match : PDZ (HMM E-Value=1.3e-40) Length = 933 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = +3 Query: 180 SGQFSKRHPRDVTWDKQVGGGKVFGTLGQNDDGLFGKAGYNREIFNDDRGKLTGQAYGTR 359 S S+ P+ +W ++ VF D F + G+ R+ ++ RG+ A T Sbjct: 692 SSSTSESSPKRFSWSQENSKDVVFAGPDLPADNPFNREGFGRQSMSEKRGRAAVDAKKTE 751 Query: 360 V 362 V Sbjct: 752 V 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,020,474 Number of Sequences: 59808 Number of extensions: 558458 Number of successful extensions: 1316 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1315 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -