BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F05 (893 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M13149-1|AAA52694.1| 525|Homo sapiens HRG protein. 33 1.8 BC069574-1|AAH69574.1| 525|Homo sapiens histidine-rich glycopro... 33 1.8 AB005803-1|BAA21613.1| 525|Homo sapiens histidine-rich glycopro... 33 1.8 AK091690-1|BAC03721.1| 240|Homo sapiens protein ( Homo sapiens ... 32 3.2 AB016898-1|BAA78633.1| 254|Homo sapiens HGC6.4 protein. 32 3.2 >M13149-1|AAA52694.1| 525|Homo sapiens HRG protein. Length = 525 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 164 PKGEHSVLYCPQMAEPDCENPEVHDFVDHVGPCDVP 271 P G H + P P +P HDF D+ GPCD P Sbjct: 386 PHGHHPHGHHPHGHHPHGHHPHCHDFQDY-GPCDPP 420 >BC069574-1|AAH69574.1| 525|Homo sapiens histidine-rich glycoprotein protein. Length = 525 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 164 PKGEHSVLYCPQMAEPDCENPEVHDFVDHVGPCDVP 271 P G H + P P +P HDF D+ GPCD P Sbjct: 386 PHGHHPHGHHPHGHHPHGHHPHCHDFQDY-GPCDPP 420 >AB005803-1|BAA21613.1| 525|Homo sapiens histidine-rich glycoprotein protein. Length = 525 Score = 32.7 bits (71), Expect = 1.8 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 164 PKGEHSVLYCPQMAEPDCENPEVHDFVDHVGPCDVP 271 P G H + P P +P HDF D+ GPCD P Sbjct: 386 PHGHHPHGHHPHGHHPHGHHPHCHDFQDY-GPCDPP 420 >AK091690-1|BAC03721.1| 240|Homo sapiens protein ( Homo sapiens cDNA FLJ34371 fis, clone FEBRA2017200. ). Length = 240 Score = 31.9 bits (69), Expect = 3.2 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = -3 Query: 270 GTSHGPTWSTKSWTSGFSQSGSAI*GQYRTECSPFGHFLVWKML 139 G GP W + WT G G R P G ++ W +L Sbjct: 61 GAGFGPDWRVRVWTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVL 104 >AB016898-1|BAA78633.1| 254|Homo sapiens HGC6.4 protein. Length = 254 Score = 31.9 bits (69), Expect = 3.2 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = -3 Query: 270 GTSHGPTWSTKSWTSGFSQSGSAI*GQYRTECSPFGHFLVWKML 139 G GP W + WT G G R P G ++ W +L Sbjct: 75 GAGFGPDWRVRVWTGGAGSKWGCSAGSGRAVLGPNGRWVPWAVL 118 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,855,525 Number of Sequences: 237096 Number of extensions: 2212652 Number of successful extensions: 6392 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6392 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11492727354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -