BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F04 (917 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U32305-14|AAK18857.1| 140|Caenorhabditis elegans Ribosomal prot... 135 4e-32 >U32305-14|AAK18857.1| 140|Caenorhabditis elegans Ribosomal protein, large subunitprotein 23 protein. Length = 140 Score = 135 bits (327), Expect = 4e-32 Identities = 66/92 (71%), Positives = 75/92 (81%) Frame = +3 Query: 159 AVINCADNTGGKEICM*SQSKXIKGRLNRLPAAGSGDMIVATVKKGKPELRKKVMPAVVI 338 AV+NCADNTG K + + S I+GRLNRLP+AG GDM V +VKKGKPELRKKV+ VVI Sbjct: 24 AVMNCADNTGAKNLFVISVY-GIRGRLNRLPSAGVGDMFVCSVKKGKPELRKKVLQGVVI 82 Query: 339 RQRKPFRRRDGVFIYFEDNAGVIVNNKGRNEG 434 RQRK FRR+DG FIYFEDNAGVIVNNKG +G Sbjct: 83 RQRKQFRRKDGTFIYFEDNAGVIVNNKGEMKG 114 Score = 57.2 bits (132), Expect = 2e-08 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 418 RGEMKGSAITGPVAKECADLWPRIAS 495 +GEMKGSAITGPVAKECADLWPRIA+ Sbjct: 109 KGEMKGSAITGPVAKECADLWPRIAA 134 Score = 37.1 bits (82), Expect = 0.018 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +2 Query: 116 AGAXFRISLGLPVGSSNQLRRQHRGQRNLYVIAVQG 223 +GA FRISLGLPVG+ + G +NL+VI+V G Sbjct: 10 SGAKFRISLGLPVGAVMNC-ADNTGAKNLFVISVYG 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,091,265 Number of Sequences: 27780 Number of extensions: 254067 Number of successful extensions: 514 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2349764032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -