BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F03 (889 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0819 + 7949938-7950678 29 3.7 06_02_0061 - 11043183-11043417,11043556-11043796,11043923-110441... 29 4.9 >08_01_0819 + 7949938-7950678 Length = 246 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -1 Query: 367 PLPTH--SL*QYSHGVPSLVNDQVVNYILDDGALALGSHIPSSDGQHCRSRR*GCCCTVS 194 PLP+H S+ H +PSL + V D G A S + CR+ R C+V+ Sbjct: 2 PLPSHFPSISFLLHLIPSLFSSSCVASDNDGGGRARDDDTVLSHQRPCRAGRMPAACSVT 61 Query: 193 P 191 P Sbjct: 62 P 62 >06_02_0061 - 11043183-11043417,11043556-11043796,11043923-11044106, 11044228-11044437,11045135-11045423,11045787-11045923, 11046019-11046137,11046405-11046518,11046710-11046803 Length = 540 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 554 NFQLTSFSMLVYTIAVGNSLIGGIGCG 474 +F T + +L Y +A+ SL+GGIG G Sbjct: 58 HFIWTYYCVLKYVLAISGSLLGGIGYG 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,676,148 Number of Sequences: 37544 Number of extensions: 425075 Number of successful extensions: 1277 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1277 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -