BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F03 (889 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34669| Best HMM Match : DUF572 (HMM E-Value=1.6e-39) 31 1.6 SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) 30 2.9 >SB_34669| Best HMM Match : DUF572 (HMM E-Value=1.6e-39) Length = 593 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/74 (29%), Positives = 35/74 (47%) Frame = +2 Query: 197 NCTTASSPATTTVLSVRAWNMRAKGKGSIIQNVVNNLIIDKRRNTMGVLLQAVGRQRTGN 376 +C AT + ++RA +IQ + N I +RR T + L A + R G Sbjct: 100 HCDAIVKKATKRLYAIRALKKSGLSSNDLIQ--IGNTI--QRRETACIALVAKAK-RGGP 154 Query: 377 C*KVLPIKL*THHG 418 +++PI + THHG Sbjct: 155 LKRLIPIPVATHHG 168 >SB_42815| Best HMM Match : rve (HMM E-Value=0.00022) Length = 1514 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +2 Query: 134 SPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWNMRAKGKG 277 +PP+R S R+ SR T S+P T + S RA + R K KG Sbjct: 1359 APPSRTSTPRSRSTPRSRSRSRTRTPSTPFTPSTTSSRA-SSRGKAKG 1405 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,385,622 Number of Sequences: 59808 Number of extensions: 466404 Number of successful extensions: 1204 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -