BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_F03 (889 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110498-7|CAB57909.2| 302|Caenorhabditis elegans Hypothetical ... 30 1.9 Z78062-8|CAD56570.2| 299|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z78062-7|CAD56571.2| 270|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z78062-6|CAN99661.1| 274|Caenorhabditis elegans Hypothetical pr... 29 4.4 AL021571-10|CAD56601.2| 299|Caenorhabditis elegans Hypothetical... 29 4.4 AL021571-9|CAA16511.3| 270|Caenorhabditis elegans Hypothetical ... 29 4.4 AL021571-8|CAN99720.1| 274|Caenorhabditis elegans Hypothetical ... 29 4.4 >AL110498-7|CAB57909.2| 302|Caenorhabditis elegans Hypothetical protein Y64G10A.1 protein. Length = 302 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 125 CACSPPARASLNYPRTLLTKTSRRNCTTASSPATTTVLSVRAWN 256 CA + A ++LNY RT L+ +NC P TT + + A N Sbjct: 38 CATTCGACSNLNYTRTCLS-DGLKNCACVGEPTTTMLCNTIACN 80 >Z78062-8|CAD56570.2| 299|Caenorhabditis elegans Hypothetical protein T19A6.1b protein. Length = 299 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 20 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 56 >Z78062-7|CAD56571.2| 270|Caenorhabditis elegans Hypothetical protein T19A6.1a protein. Length = 270 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 16 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 52 >Z78062-6|CAN99661.1| 274|Caenorhabditis elegans Hypothetical protein T19A6.1c protein. Length = 274 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 20 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 56 >AL021571-10|CAD56601.2| 299|Caenorhabditis elegans Hypothetical protein T19A6.1b protein. Length = 299 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 20 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 56 >AL021571-9|CAA16511.3| 270|Caenorhabditis elegans Hypothetical protein T19A6.1a protein. Length = 270 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 16 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 52 >AL021571-8|CAN99720.1| 274|Caenorhabditis elegans Hypothetical protein T19A6.1c protein. Length = 274 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 621 QVLXYLVLWIXKYTLLFSHQGNELPTDEFQYAXLHHRR 508 +V +L++ I K+ F G +P FQY +HHRR Sbjct: 20 KVSTWLIMGITKFFQFFIIVGGSIPY-VFQYVEIHHRR 56 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,696,205 Number of Sequences: 27780 Number of extensions: 341983 Number of successful extensions: 1019 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1019 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -