BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E22 (958 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 25 0.87 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 25 1.2 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 25.0 bits (52), Expect = 0.87 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 227 VSGTFPILGKCPSESESAHHNAAXLLXPPTHVRRVTGXP 111 V+ TF L P+E+ N P T +R + G P Sbjct: 249 VTSTFDFLSLHPAETSMNDANRNDCAKPLTQIRNIPGPP 287 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 227 VSGTFPILGKCPSESESAHHNAAXLLXPPTHVRRVTGXP 111 V+ TF L P+E+ N P T +R + G P Sbjct: 249 VTSTFDFLSLHPAETSMNDVNRNDCAKPLTQIRNIPGPP 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,229 Number of Sequences: 336 Number of extensions: 1334 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26996013 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -