BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E21 (900 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 3.9 SB_56633| Best HMM Match : CbiX (HMM E-Value=4.6) 29 6.8 SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 >SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1022 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = -3 Query: 367 CQIFIKFVEAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTSQP 236 C+ F+K + + + F GQ F+ F++C TSQP Sbjct: 104 CEYFMKKCDKEFEMIRKFNEMNNGQWNFSILGTFMDCARDTSQP 147 >SB_56633| Best HMM Match : CbiX (HMM E-Value=4.6) Length = 344 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 412 DVLFFIYNREFNDALGARYDRE 477 ++ F I REF DALG RYD E Sbjct: 103 EMSFDIKKREFKDALGLRYDWE 124 >SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 412 DVLFFIYNREFNDALGARYDRE 477 ++ F I REF DALG RYD E Sbjct: 820 EMSFDIKKREFKDALGLRYDWE 841 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,323,132 Number of Sequences: 59808 Number of extensions: 312879 Number of successful extensions: 750 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 749 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -