BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E16 (1089 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0777 + 25110356-25110662,25112569-25112789,25112880-251131... 29 8.5 >01_05_0777 + 25110356-25110662,25112569-25112789,25112880-25113127, 25113274-25113664,25113751-25114155,25115260-25115366, 25115833-25116170,25116206-25116486,25116645-25116889, 25116998-25117382,25117459-25117884 Length = 1117 Score = 28.7 bits (61), Expect = 8.5 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = +3 Query: 222 REAEWGWRTPERLPRNFFSKGNXSKTTQXPKGKFPIKGTFKKQTR 356 R EW W P RL R ++G + P G P+ + R Sbjct: 32 RAMEWAWWRPRRLERALRAQGLRGTPYRSPAGDAPLNVQLSAEAR 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,528,748 Number of Sequences: 37544 Number of extensions: 383798 Number of successful extensions: 810 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3257937684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -