BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E15 (914 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0465 + 3640736-3640817,3640898-3641088,3641266-3641789,364... 33 0.32 02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659,376... 30 2.2 09_01_0142 - 2103224-2103864,2104264-2104399 29 3.9 09_04_0188 - 15410310-15410514,15410597-15410748,15410845-154110... 29 6.8 11_06_0202 - 21184217-21184503,21184622-21184982 28 9.0 03_03_0236 - 15696495-15696977,15697290-15697339,15699867-15699906 28 9.0 >12_01_0465 + 3640736-3640817,3640898-3641088,3641266-3641789, 3643726-3644029 Length = 366 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -3 Query: 606 ILKYTLLFSHQGNELPTDEVQYACLHHRRRQFSHSRGL 493 ILK F+ G +P D+ CL+ R+R+F H+ GL Sbjct: 179 ILKKPYDFNPDGRIVPADKPSQTCLNKRQREFLHALGL 216 >02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659, 3769736-3769990,3770763-3770934,3772260-3772910, 3773659-3774045,3774123-3774155,3774239-3774307, 3774388-3774463,3775135-3775223,3775442-3775615, 3775693-3775821 Length = 907 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 137 IARRQRGRSLNYPRTLLTKNSRRNCTTASSPANYDSAVRQS---LEYEKPRQGLHHPECS 307 I RG+ ++P T+ RR T A +P N + S L E R+ +HH C+ Sbjct: 479 ICSESRGKRGDWPNMKATRRGRRR-THALTPDNEEEEENLSELELAVENTRRRIHHCNCN 537 Query: 308 *QPDH 322 P H Sbjct: 538 HIPRH 542 >09_01_0142 - 2103224-2103864,2104264-2104399 Length = 258 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 370 RQRTGNC*KVLPIKL*THHGRK-LCQD-HLQKLQPRSEARFHNQSPRMRE 513 RQ T + K P++ +HGR + +D H L P S A+ HNQ P R+ Sbjct: 36 RQLTRHLIKYAPVQ--ANHGRSNIARDVHKSLLVPVSAAKVHNQKPAPRD 83 >09_04_0188 - 15410310-15410514,15410597-15410748,15410845-15411003, 15411062-15411367,15412508-15412535,15413174-15413290, 15413649-15413717,15413919-15414103 Length = 406 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -3 Query: 603 LKYTLLFSHQGNELPTDEVQYACLHHRRRQFSHSRGLVVEP 481 L +TL + +G ++E+ HHR R+ SH G++ P Sbjct: 127 LNHTLFQTRKGGPQESEELGEDIRHHRLRRRSHGHGVLQGP 167 >11_06_0202 - 21184217-21184503,21184622-21184982 Length = 215 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 200 SSSWLEVSADSSTNARAGGEQC 135 SS+WL A ++++A AGGE C Sbjct: 20 SSAWLPSPASAASDAAAGGEYC 41 >03_03_0236 - 15696495-15696977,15697290-15697339,15699867-15699906 Length = 190 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 621 YLVLWILKYTLLFSHQGNELPTDEVQYACLHHRRRQFSHSRGLV 490 Y++ ++ LFS QG LP D+ + + RR SH G+V Sbjct: 20 YVLERVVAQFYLFSSQGRPLPDDDGITSEMQIRRYLLSHGNGVV 63 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,007,136 Number of Sequences: 37544 Number of extensions: 435379 Number of successful extensions: 1161 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -