BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E15 (914 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 35 0.004 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 35 0.004 AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-tran... 33 0.016 AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 28 0.34 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 27 1.0 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 27 1.0 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 26 1.4 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 26 1.4 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 26 1.4 AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. 26 1.4 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 26 1.4 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 25 4.2 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 5.6 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 24 5.6 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 7.4 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 34.7 bits (76), Expect = 0.004 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 442 QDHLQKLQPRSEARFHNQS-PRMRELPTAMV*TSILNLVSWKFITLVGEQQSVLQD 606 Q + L S+AR+H+ + +MR+L ++ T++L++V+W IT GE + D Sbjct: 108 QTNTHPLFAESDARYHSIALAKMRKLLVLVMATTVLSVVAWVTITFFGESVKTVLD 163 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 34.7 bits (76), Expect = 0.004 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 442 QDHLQKLQPRSEARFHNQS-PRMRELPTAMV*TSILNLVSWKFITLVGEQQSVLQD 606 Q + L S+AR+H+ + +MR+L ++ T++L++V+W IT GE + D Sbjct: 108 QTNTHPLFAESDARYHSIALAKMRKLLVLVMATTVLSVVAWVTITFFGESVKTVLD 163 >AF316635-1|AAG45163.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 32.7 bits (71), Expect = 0.016 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = +1 Query: 133 LHCSPPARAFVELSADTSNQELEEKLYNSILTGE 234 +H SPP RA VEL+A ELE KL N +L GE Sbjct: 9 VHLSPPCRA-VELTAKALGLELERKLVN-LLAGE 40 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 28.3 bits (60), Expect = 0.34 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 Query: 142 SPPARAFVELSADTSNQELEEKLYNSILTGE 234 SPP RA VEL+A ELE KL N +L G+ Sbjct: 12 SPPCRA-VELTAKALGLELERKLVN-LLAGQ 40 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.6 bits (56), Expect = 1.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 445 DHLQKLQPRSEARFHNQSPRMRELPTAMV*TSIL 546 DH+ +L PR + R+H+ S + PT + T++L Sbjct: 445 DHVCELLPRLQPRYHSISSSSKLHPTTVHVTAVL 478 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 26.6 bits (56), Expect = 1.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 448 HLQKLQPRSEARFHNQSPRMRELP 519 H +LQP+ + RFH QSP R P Sbjct: 220 HQHQLQPQ-QRRFHRQSPAHRRKP 242 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 835 GRWTXXXXSPGLPD---IYSWFITPFLN 909 GRWT P LP+ IY W F N Sbjct: 75 GRWTFDTNKPALPNGTIIYYWVYVQFAN 102 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 835 GRWTXXXXSPGLPD---IYSWFITPFLN 909 GRWT P LP+ IY W F N Sbjct: 75 GRWTFDTNKPALPNGTIIYYWVYVQFAN 102 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 835 GRWTXXXXSPGLPD---IYSWFITPFLN 909 GRWT P LP+ IY W F N Sbjct: 75 GRWTFDTNKPALPNGTIIYYWVYVQFAN 102 >AY341184-1|AAR13748.1| 187|Anopheles gambiae GNBP A1 protein. Length = 187 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 835 GRWTXXXXSPGLPD---IYSWFITPFLN 909 GRWT P LP+ IY W F N Sbjct: 75 GRWTFDTNKPALPNGTIIYYWVYVQFAN 102 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 835 GRWTXXXXSPGLPD---IYSWFITPFLN 909 GRWT P LP+ IY W F N Sbjct: 75 GRWTFDTNKPALPNGTIIYYWVYVQFAN 102 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 24.6 bits (51), Expect = 4.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 802 RYXRERLGRPQGRWTXXXXSPGLPDIYSWFITPFLN 909 R E + R Q +WT PG P + + + P +N Sbjct: 863 RQREETMRRWQDQWTTGAGQPGAPGLKTRRLIPDIN 898 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 24.2 bits (50), Expect = 5.6 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = -2 Query: 337 SVSLSMIRLLTTFWMMEPLPWL 272 ++ L+++ +LT +W M LP+L Sbjct: 94 TMPLTLVEILTKYWPMGRLPFL 115 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 24.2 bits (50), Expect = 5.6 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 585 FSH-QGNELPTDEVQYACLHHRRRQFSHSRGL 493 FS+ Q + T+ V +A HH++ Q HS G+ Sbjct: 4 FSYLQNGKASTNGVPHANGHHQQHQNGHSNGV 35 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.8 bits (49), Expect = 7.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 230 ANYDSAVRQSLEYEKPRQGLHHPE 301 +NYD+AVR L P HH + Sbjct: 340 SNYDAAVRIPLVIRAPGMQTHHQQ 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 838,155 Number of Sequences: 2352 Number of extensions: 16757 Number of successful extensions: 47 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 99228240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -