BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E12 (899 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0474 + 18162538-18163731,18163800-18163855,18163951-181640... 29 5.0 04_01_0288 + 3824337-3826385 29 6.7 >11_04_0474 + 18162538-18163731,18163800-18163855,18163951-18164011, 18164107-18165495,18166024-18166635,18166706-18166852, 18166941-18167209,18167322-18167412,18167500-18167757, 18168376-18168450,18168937-18168945 Length = 1386 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = +2 Query: 239 HIFDTFWCSXXXXXXXXXXXXLNCRSISGS----RCCYQNLESKYSES 370 H+ D FWC + CRS G+ R C++NL+ + ES Sbjct: 331 HVLDVFWC---MIQLLRDPILMFCRSFEGACTRLRTCFENLKPLFPES 375 >04_01_0288 + 3824337-3826385 Length = 682 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 407 SQTLSRFDIAKSRLKKFKQWKTSNGQVKTLSDLPLIEGFTDKTAKKLCDSILNGP 571 S + ++++ S K + TS+ KTL+DL + GF D + C S L P Sbjct: 381 SGRMGQYNMLHSCYHKITKATTSHHWFKTLNDLSTLVGFADWLDMQHCSSNLEIP 435 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,381,913 Number of Sequences: 37544 Number of extensions: 347960 Number of successful extensions: 731 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -