BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E12 (899 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 28 0.44 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 1.8 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 7.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 7.2 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 9.6 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 27.9 bits (59), Expect = 0.44 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 314 SISGSRCCYQNLESKYSESQKVKILNVINDDSQTLSRFDIAKSRLKK 454 S + ++C + L+++ + +KIL + S + S+ DIAK+ LKK Sbjct: 356 SENAAQCFEKVLKAQPGNYETMKILGSLYATSSSQSKRDIAKNHLKK 402 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 1.8 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 121 TNVFALLTYIINIYKVQAC 177 +N+F L Y++ IYKV+ C Sbjct: 1249 SNMFELSDYLVGIYKVKDC 1267 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 7.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 468 FHCLNFFNLDFAISNLDN 415 FHC NF +LD A+ + + Sbjct: 368 FHCSNFISLDEAVCSFSS 385 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 7.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 277 NKLYRTPKCIKNVVIGCTYLL 215 N L +TP C+K V G LL Sbjct: 964 NVLVQTPSCVKITVFGLAKLL 984 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 9.6 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 688 SVCWTLINKMIMKLWSGSII 747 S CW+ K++ WS SI+ Sbjct: 335 SGCWSRARKLVAAAWSFSIL 354 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 843,549 Number of Sequences: 2352 Number of extensions: 17834 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97160985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -