BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E12 (899 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40954-8|AAM69083.2| 471|Caenorhabditis elegans Hypothetical pr... 29 3.4 U41554-9|AAP82650.1| 328|Caenorhabditis elegans Multidrug resis... 29 4.5 U41554-8|ABA03118.1| 1534|Caenorhabditis elegans Multidrug resis... 29 4.5 U41554-7|AAM69107.1| 1534|Caenorhabditis elegans Multidrug resis... 29 4.5 U41554-6|AAL06032.1| 1534|Caenorhabditis elegans Multidrug resis... 29 4.5 U41554-5|AAD31550.2| 1528|Caenorhabditis elegans Multidrug resis... 29 4.5 U66260-1|AAB07021.1| 1540|Caenorhabditis elegans multidrug resis... 29 6.0 AC006769-1|AAF60590.2| 287|Caenorhabditis elegans Hypothetical ... 29 6.0 AC006722-17|ABP57812.1| 141|Caenorhabditis elegans Hypothetical... 29 6.0 AB199793-1|BAD88409.1| 1534|Caenorhabditis elegans multidrug res... 29 6.0 >U40954-8|AAM69083.2| 471|Caenorhabditis elegans Hypothetical protein ZK813.5 protein. Length = 471 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/56 (21%), Positives = 31/56 (55%) Frame = -1 Query: 716 ILFISVQQTELTDIYTVNTVLQSLIVLSFKFGCNIDLLFYLIFVQLLQWVHLIYCH 549 + +++++T+ + T N +L + +++S F + ++ LI ++L+YCH Sbjct: 14 LAIVTIKETQSASLRTTNAILIAALLVSSYFLNVLFIVAVLITKSFRTTIYLMYCH 69 >U41554-9|AAP82650.1| 328|Caenorhabditis elegans Multidrug resistance protein familyprotein 1, isoform d protein. Length = 328 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 262 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKLLSNPD 315 >U41554-8|ABA03118.1| 1534|Caenorhabditis elegans Multidrug resistance protein familyprotein 1, isoform e protein. Length = 1534 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1468 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKLLSNPD 1521 >U41554-7|AAM69107.1| 1534|Caenorhabditis elegans Multidrug resistance protein familyprotein 1, isoform c protein. Length = 1534 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1468 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKLLSNPD 1521 >U41554-6|AAL06032.1| 1534|Caenorhabditis elegans Multidrug resistance protein familyprotein 1, isoform b protein. Length = 1534 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1468 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKLLSNPD 1521 >U41554-5|AAD31550.2| 1528|Caenorhabditis elegans Multidrug resistance protein familyprotein 1, isoform a protein. Length = 1528 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1462 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKLLSNPD 1515 >U66260-1|AAB07021.1| 1540|Caenorhabditis elegans multidrug resistance related protein1 protein. Length = 1540 Score = 28.7 bits (61), Expect = 6.0 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1474 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKVLSNPD 1527 >AC006769-1|AAF60590.2| 287|Caenorhabditis elegans Hypothetical protein Y45G12C.8 protein. Length = 287 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = -1 Query: 659 VLQSLIVLSFKFGCNIDLLFYLIFVQL 579 V +S+I++ FKFG + ++F++ FV++ Sbjct: 38 VNRSMILIYFKFGLDAIIMFFMFFVEI 64 >AC006722-17|ABP57812.1| 141|Caenorhabditis elegans Hypothetical protein Y19D10A.17 protein. Length = 141 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/27 (37%), Positives = 21/27 (77%) Frame = -1 Query: 659 VLQSLIVLSFKFGCNIDLLFYLIFVQL 579 V +S+I++ FKFG + ++F++ FV++ Sbjct: 38 VNRSMILIYFKFGLDAIIMFFMFFVEI 64 >AB199793-1|BAD88409.1| 1534|Caenorhabditis elegans multidrug resistance-associatedprotein protein. Length = 1534 Score = 28.7 bits (61), Expect = 6.0 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +1 Query: 610 SILHPNLKESTIKDCKTVLTVYISVNSVCWTLINKMIMKLWSGSIIVLITPKERRSDPD 786 S+L ++E KDC TVLT+ +N+V + + ++ L G + TPK+ S+PD Sbjct: 1468 SLLQKTIREQ-FKDC-TVLTIAHRLNTV---MDSDRLLVLDKGCVAEFDTPKKVLSNPD 1521 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,585,468 Number of Sequences: 27780 Number of extensions: 377241 Number of successful extensions: 898 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2286823924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -