BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E09 (880 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 4.2 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 7.3 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 7.3 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 22 7.3 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 22 7.3 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 7.3 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 7.3 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.6 bits (46), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 281 VMPDFSRAPLCSDAAVDSWLHYFELDAP 364 V+P +R PL S ++ S L L+AP Sbjct: 10 VIPTMARTPLKSSFSISSILPETALEAP 37 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 240 PRPTTLSP**VFNVSRMDVIKLDLPVRFFATTL 142 P+PT L P FN+ R+ ++ FF L Sbjct: 237 PKPTPLVPQQGFNMERLLAPSTEVSAPFFRQPL 269 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 630 LLVLAGVGPSILWMI*SRPKVW 565 L+VL P++L + SRP+ W Sbjct: 115 LMVLLVCTPTVLVEVNSRPETW 136 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 630 LLVLAGVGPSILWMI*SRPKVW 565 L+VL P++L + SRP+ W Sbjct: 115 LMVLLVCTPTVLVEVNSRPETW 136 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 695 FSKHSTCFIYYNII*GAVSKVPCSSSRVSD 606 F+ S C +++N G S+ CS D Sbjct: 102 FADESKCDVFWNCWNGEASRYQCSPGLAYD 131 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 695 FSKHSTCFIYYNII*GAVSKVPCSSSRVSD 606 F+ S C +++N G S+ CS D Sbjct: 102 FADESKCDVFWNCWNGEASRYQCSPGLAYD 131 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 7.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 488 TPEDVHYEG 514 TPE +HYEG Sbjct: 47 TPESLHYEG 55 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 7.3 Identities = 14/71 (19%), Positives = 31/71 (43%) Frame = +3 Query: 15 TXSTNRGNSFKNFSSNSCPTNEEQELRCSETNC*RKGNPER*LKWSRRTARASPTLSRPS 194 T +T++ S S++S + E+ + + + NP + W +R T++ Sbjct: 159 TSTTSQNLSSPASSTSSTSSTEKAGTNNNNSKSSQSSNPPQIYPWMKRVHLGQSTVNANG 218 Query: 195 ERH*RLTTETK 227 E + T+ T+ Sbjct: 219 ETKRQRTSYTR 229 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,838 Number of Sequences: 336 Number of extensions: 1981 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24306755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -