BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E07 (1221 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.094 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 32 0.66 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 32 0.66 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 31 2.0 At1g61080.1 68414.m06877 proline-rich family protein 30 2.7 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 25 3.9 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 29 4.7 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 4.7 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 29 4.7 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 26 6.5 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 8.2 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 8.2 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.1 bits (77), Expect = 0.094 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 496 GGPPPPPXFXKXKXXXGXXGGXPXPPPXGGGXXXXXPXGKXFXGGG 633 GGPPPPP GG P PPP GG P G G G Sbjct: 677 GGPPPPPP---------PPGGGPPPPPGGGPPPPPPPPGALGRGAG 713 Score = 29.1 bits (62), Expect = 6.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 552 GGXPPPPPXXGGXXXXXPRG 611 GG PPPPP GG P G Sbjct: 677 GGPPPPPPPPGGGPPPPPGG 696 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = -2 Query: 701 PPPXXGXKKXKKXXXXPXXXKKXPPPXXFXPXGXXXXXPPPXGGGXGXPPXXP 543 PPP G + + P + P P G PPP G G PP P Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRP 234 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 427 FKXVXPPQXGXXPFXPQKKXFXXGGPPPPPXFXKXKXXXGXXGGXPXPPPXGGGXXXXXP 606 F PPQ G P P G PPPP G P PP GG P Sbjct: 195 FSGPPPPQYGQRPMIPPPGGMMRGPPPPP------HGMQGPPPPRPGMPPAPGGFAPPRP 248 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = -2 Query: 701 PPPXXGXKKXKKXXXXPXXXKKXPPPXXFXPXGXXXXXPPPXGGGXGXPPXXP 543 PPP G + + P + P P G PPP G G PP P Sbjct: 182 PPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRP 234 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +1 Query: 427 FKXVXPPQXGXXPFXPQKKXFXXGGPPPPPXFXKXKXXXGXXGGXPXPPPXGGGXXXXXP 606 F PPQ G P P G PPPP G P PP GG P Sbjct: 195 FSGPPPPQYGQRPMIPPPGGMMRGPPPPP------HGMQGPPPPRPGMPPAPGGFAPPRP 248 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 496 GGPPPPPXFXKXKXXXGXXGGXPXPPPXGG 585 GGPPPPP GG PPP G Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMG 278 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = -2 Query: 701 PPPXXGXKKXKKXXXXPXXXKKXPPPXXFXPXGXXXXXPPP---XGGGXGXPPXXP 543 PPP G P + PPP P PPP G G PP P Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 25.0 bits (52), Expect(2) = 3.9 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 502 PPPPPXFXKXKXXXGXXGGXPXPPP 576 PPPPP F P PPP Sbjct: 508 PPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 23.0 bits (47), Expect(2) = 3.9 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = +1 Query: 442 PPQXGXXPFXPQKKXFXXGGPPPPP 516 PP P F PPPPP Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPP 508 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = -2 Query: 653 PXXXKKXPPPXXFXPXGXXXXXPP--PXGGGXGXPPXXPXXXFXX*KXGGGGGP 498 P + P F P G P P GG G P P + GGGGGP Sbjct: 52 PGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGP 105 Score = 28.7 bits (61), Expect = 8.2 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = -2 Query: 632 PPPXXFXPXGXXXXXPPPXGGGXGXPPXXPXXXFXX*KXGGGGGPPXXKXFFWGXKGXXP 453 P F P G P G G G P + GGGGGP + G +G P Sbjct: 42 PGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGPGP--WSGPRGPRP 99 Query: 452 XCGG 441 GG Sbjct: 100 GGGG 103 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 508 PPPXFXKXKXXXGXXGGXPXPPPXGGGXXXXXPXGKXFXGGG 633 P P K G GG PPP GG P GGG Sbjct: 33 PHPPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGG 74 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = -2 Query: 701 PPPXXGXKKXKKXXXXPXXXKKXPPPXXFXPXGXXXXXPPPXGG--GXGXPPXXP 543 PP G P PPP G PPP G G G PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 28.7 bits (61), Expect = 8.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 442 PPQXGXXPFXPQKKXFXXGGPPPPPXFXKXKXXXGXXGGXPXPPPXGGGXXXXXPXG 612 PP P P K PPPPP G G P PPP P G Sbjct: 389 PPSAAAPPPPPPPKKGPAAPPPPPP--------PGKKGAGPPPPPPMSKKGPPKPPG 437 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1110 PPPPXXXXXXFFXXPXXXXGGGGGXXPPPPXXKKK 1214 PPPP P G G PPPP KK Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKK 430 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 26.2 bits (55), Expect(2) = 6.5 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +1 Query: 499 GPPPPPXFXKXKXXXGXXGGXPXPPP 576 GPPPPP + P PPP Sbjct: 600 GPPPPPPPPPLQSHRSALSSSPLPPP 625 Score = 21.0 bits (42), Expect(2) = 6.5 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 463 PFXPQKKXFXXGGPPPPP 516 P P K PPPPP Sbjct: 558 PLPPLKPLRILSRPPPPP 575 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = -2 Query: 701 PPPXXGXKKXKKXXXXPXXXKKXPPPXXFXPXGXXXXXPPPXGGGXGXPPXXP 543 PPP G + P + P P G PPP G G PP P Sbjct: 173 PPPPYGMRPPYPGPPPPQYGGQQRP-MMIPPPGGMMRGPPPPHGMQGPPPSRP 224 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 502 PPPPPXFXKXKXXXGXXGGXPXPPPXGGG 588 PPPPP F + G G P PPP G Sbjct: 296 PPPPPQFLNHQQGFG--GPRPPPPPQAMG 322 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,164,344 Number of Sequences: 28952 Number of extensions: 334699 Number of successful extensions: 1176 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 12,070,560 effective HSP length: 83 effective length of database: 9,667,544 effective search space used: 3122616712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -