BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_E03 (878 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 23 9.3 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 9.3 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 23.4 bits (48), Expect = 9.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 490 YXDEFGQTTTKMQ*KKCFICEIXDAIALFVT 582 + D GQ T + + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 Query: 345 SLLGRRWFPFFKTITEAP 292 S G+ W+ +K I EAP Sbjct: 251 SFTGKMWYQVYKQIREAP 268 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 670,780 Number of Sequences: 2352 Number of extensions: 11018 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -