BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D24 (908 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3573|AAM68241.1| 122|Drosophila melanogaster CG30413-P... 34 0.31 AE013599-2754|ABC66050.1| 119|Drosophila melanogaster CG33998-P... 34 0.31 >AE013599-3573|AAM68241.1| 122|Drosophila melanogaster CG30413-PA protein. Length = 122 Score = 33.9 bits (74), Expect = 0.31 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = +3 Query: 354 AEASITAGGXGFSYANIKLKSPRGSGLXYQLEIY 455 A A IT+GG G + IK S RG+G+ Q+ IY Sbjct: 86 ATAEITSGGVGSTTVTIKFTSARGAGIKSQVVIY 119 >AE013599-2754|ABC66050.1| 119|Drosophila melanogaster CG33998-PA protein. Length = 119 Score = 33.9 bits (74), Expect = 0.31 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 342 DHSDAEASITAGGXGFSYANIKLKSPRGSGLXYQLEIY 455 D + A +TAGG +YA I LKS R G + ++IY Sbjct: 80 DGNGGYAYLTAGGPQTTYAKIHLKSQRNQGFSFIIDIY 117 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,092,017 Number of Sequences: 53049 Number of extensions: 424749 Number of successful extensions: 747 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4443987051 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -