BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D23 (917 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 1e-24 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 103 2e-22 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 89 5e-18 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 82 5e-16 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 52 5e-07 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 45 7e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 7e-05 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 45 1e-04 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 44 1e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 44 1e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 44 1e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 44 1e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 44 1e-04 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 44 1e-04 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 44 1e-04 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 44 2e-04 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 44 2e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 44 2e-04 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 44 2e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 44 2e-04 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 44 2e-04 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 44 2e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 44 2e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 44 2e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 44 2e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 44 2e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 44 2e-04 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 44 2e-04 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 44 2e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 44 2e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 44 2e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 44 2e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 44 2e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 44 2e-04 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 44 2e-04 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 44 2e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 44 2e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 44 2e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 44 2e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 44 2e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 44 2e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 44 2e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 44 2e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 44 2e-04 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 44 2e-04 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 44 2e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 44 2e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 44 2e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 44 2e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 44 2e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 44 2e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 44 2e-04 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 44 2e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 44 2e-04 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 44 2e-04 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 44 2e-04 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 2e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 44 2e-04 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 44 2e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 44 2e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 44 2e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 44 2e-04 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 44 2e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 44 2e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 44 2e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 44 2e-04 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 44 2e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 44 2e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 44 2e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 44 2e-04 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 44 2e-04 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 44 2e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 44 2e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 44 2e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 44 2e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 44 2e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 44 2e-04 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 44 2e-04 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 44 2e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 44 2e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 44 2e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 44 2e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 44 2e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 44 2e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 44 2e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 2e-04 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 44 2e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 44 2e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 44 2e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 44 2e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 2e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 44 2e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 44 2e-04 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 44 2e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 44 2e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 2e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 44 2e-04 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 44 2e-04 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 44 2e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 44 2e-04 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 44 2e-04 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 44 2e-04 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 44 2e-04 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 44 2e-04 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 44 2e-04 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 44 2e-04 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 44 2e-04 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 44 2e-04 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 44 2e-04 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 44 2e-04 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 44 2e-04 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 44 2e-04 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 44 2e-04 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 44 2e-04 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 110 bits (265), Expect = 1e-24 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -2 Query: 559 DARXGGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 D GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 72 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 109 bits (263), Expect = 2e-24 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -2 Query: 553 RXGGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 + GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 808 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 109 bits (262), Expect = 3e-24 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 547 GGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 50 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 109 bits (262), Expect = 3e-24 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 547 GGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 73 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 109 bits (262), Expect = 3e-24 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 547 GGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 455 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 109 bits (262), Expect = 3e-24 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 547 GGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 555 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 604 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 109 bits (262), Expect = 3e-24 Identities = 48/50 (96%), Positives = 48/50 (96%) Frame = -2 Query: 547 GGGAYGKTPATRXFYGSWPFAGLXLTCSFLRYPLILWITVLPPLSELIPL 398 GGGAYGKTPATR FYGSWPFAGL LTCSFLRYPLILWITVLPPLSELIPL Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPL 50 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 103 bits (247), Expect = 2e-22 Identities = 46/59 (77%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +3 Query: 627 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVXCXS-XPXAGLCAQTPYT 800 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISV C S P +C P++ Sbjct: 147 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFS 205 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +2 Query: 443 NQGITQERTCEXKASKRPXTVKXPRCWRFSIG 538 NQGITQERTCE KASKRP TVK PRCWRFSIG Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIG 117 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/59 (45%), Positives = 30/59 (50%) Frame = +1 Query: 544 PLXEHHKIDAQVRXXETRQXYKDTXXFXPWKLPXALSCSDPAAYRIPVXLSPFGKRGAF 720 PL KIDAQVR ETRQ YKDT F P + P P R+P PF R A+ Sbjct: 120 PLTSITKIDAQVRGGETRQDYKDTRRF-PLEAPSCALLFRPC--RLPDTCPPFSLREAW 175 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 94.3 bits (224), Expect = 1e-19 Identities = 42/47 (89%), Positives = 42/47 (89%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE*AD 405 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE D Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 94 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 60 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 93.5 bits (222), Expect = 2e-19 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 92.3 bits (219), Expect = 5e-19 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMF+PALSPDSVDNRITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 92.3 bits (219), Expect = 5e-19 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAF+ Sbjct: 18 GRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 89.0 bits (211), Expect = 5e-18 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 627 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVGI 743 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAV I Sbjct: 176 PLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIAHAVAI 214 Score = 68.1 bits (159), Expect = 9e-12 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 440 QNQGITQERTCEXKASKRPXTVKXPRCWRFSIG 538 +NQGITQERTCE KASKRP TVK PRCWRFSIG Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIG 146 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/59 (45%), Positives = 30/59 (50%) Frame = +1 Query: 544 PLXEHHKIDAQVRXXETRQXYKDTXXFXPWKLPXALSCSDPAAYRIPVXLSPFGKRGAF 720 PL KIDAQVR ETRQ YKDT F P + P P R+P PF R A+ Sbjct: 149 PLTSITKIDAQVRGGETRQDYKDTRRF-PLEAPSCALLFRPC--RLPDTCPPFSLREAW 204 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 87.0 bits (206), Expect = 2e-17 Identities = 39/45 (86%), Positives = 39/45 (86%) Frame = -1 Query: 548 RGGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 RG KNASNAAFLRF AFCWP AHMFFPALSPDSVDNRITAFE Sbjct: 17 RGAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 83.0 bits (196), Expect = 3e-16 Identities = 38/44 (86%), Positives = 38/44 (86%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE 414 G SLWKNASNAAFLRF AF WP AHMFF ALSPD VDNRITAFE Sbjct: 18 GRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 724 MRKRHASRREKGGQVSGKR 668 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 82.2 bits (194), Expect = 5e-16 Identities = 39/49 (79%), Positives = 39/49 (79%) Frame = -1 Query: 545 GGSLWKNASNAAFLRFXAFCWPXAHMFFPALSPDSVDNRITAFE*ADTA 399 G SLWKNASNAAFLRF AFCWP HMF PALSPDSVD ITAFE D A Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA 50 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 292 CINESANARGEAVCVLGALPLPR 360 CINESANARGEAVCVLGALPLPR Sbjct: 100 CINESANARGEAVCVLGALPLPR 122 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLTQRR 424 SLTRCARSFGCGERYQLTQRR Sbjct: 123 SLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 292 CINESANARGEAVCVLGALPLPR 360 CINESANARGEAVCVLGALPLPR Sbjct: 464 CINESANARGEAVCVLGALPLPR 486 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLTQRR 424 SLTRCARSFGCGERYQLTQRR Sbjct: 487 SLTRCARSFGCGERYQLTQRR 507 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/57 (50%), Positives = 30/57 (52%) Frame = +1 Query: 337 LGALPLPRLTDXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM*AKGQQKAXNRK 507 +G LTD HSKAVIRLSTESGDNAGKNM G KA RK Sbjct: 11 IGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMRLYG--KAIIRK 65 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 337 LGALPLPRLTDXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 471 +G LTD HSKAVIRLSTESGDNAGKNM Sbjct: 57 IGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 337 LGALPLPRLTDXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 471 +G LTD HSKAVIRLSTESGDNAGKNM Sbjct: 579 IGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 337 LGALPLPRLTDXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 471 +G LTD HSKAVIRLSTESGDNAGKNM Sbjct: 6 IGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/45 (53%), Positives = 25/45 (55%) Frame = +1 Query: 337 LGALPLPRLTDXXXXXXXXXXXXXXHSKAVIRLSTESGDNAGKNM 471 +G LTD HSKAVIRLSTESGDNAGKNM Sbjct: 144 IGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 45.2 bits (102), Expect = 7e-05 Identities = 23/43 (53%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = +2 Query: 224 KLTTTIAFILCFRFRGEVWE--VFSALMNRPTRGERRFAYWAL 346 ++ T + C R+ V + V +ALMNRPTRGERRFAYWAL Sbjct: 58 EIETNFSTNRCRRYMATVGKPVVPAALMNRPTRGERRFAYWAL 100 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 145 SLTRYARSFDCGERKWLT 162 >SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 224 KLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +L T++ L F G+ V +ALMNRPTRGERRFAYWAL Sbjct: 5 RLLVTLSLGLVFIVVGKP-VVPAALMNRPTRGERRFAYWAL 44 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +2 Query: 239 IAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 I+F FR V V +ALMNRPTRGERRFAYWAL Sbjct: 130 ISFTRIFRVGKPV--VPAALMNRPTRGERRFAYWAL 163 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 208 SLTRYARSFDCGERKWLT 225 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/43 (51%), Positives = 29/43 (67%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +N + T +++ G+ V +ALMNRPTRGERRFAYWAL Sbjct: 41 LNNMNTLTEYVILSVVVGKP-VVPAALMNRPTRGERRFAYWAL 82 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = +2 Query: 227 LTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 + +I +++ F V +ALMNRPTRGERRFAYWAL Sbjct: 157 IPVSIVYLVSFEMYVGKPVVPAALMNRPTRGERRFAYWAL 196 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +2 Query: 281 EVFSALMNRPTRGERRFAYWAL 346 +V +ALMNRPTRGERRFAYWAL Sbjct: 5 DVPAALMNRPTRGERRFAYWAL 26 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLTQR 421 SLTR ARSF CGER +R Sbjct: 88 SLTRYARSFDCGERKMAYER 107 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = +2 Query: 218 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYWAL 346 +++LT L RF V +ALMNRPTRGERRFAYWAL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 108 SLTRYARSFDCGERKWLT 125 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 116 AALMNRPTRGERRFAYWAL 134 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 73 AALMNRPTRGERRFAYWAL 91 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 121 AALMNRPTRGERRFAYWAL 139 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 120 AALMNRPTRGERRFAYWAL 138 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 183 SLTRYARSFDCGERKWLT 200 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 108 SLTRYARSFDCGERKWLT 125 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 244 AALMNRPTRGERRFAYWAL 262 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 307 SLTRYARSFDCGERKWLT 324 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 145 SLTRYARSFDCGERKWLT 162 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 69 AALMNRPTRGERRFAYWAL 87 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 132 SLTRYARSFDCGERKWLT 149 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 140 AALMNRPTRGERRFAYWAL 158 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 94 AALMNRPTRGERRFAYWAL 112 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 157 SLTRYARSFDCGERKWLT 174 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 58 AALMNRPTRGERRFAYWAL 76 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 154 AALMNRPTRGERRFAYWAL 172 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 51 AALMNRPTRGERRFAYWAL 69 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 114 SLTRYARSFDCGERKWLT 131 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 81 AALMNRPTRGERRFAYWAL 99 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 144 SLTRYARSFDCGERKWLT 161 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 199 AALMNRPTRGERRFAYWAL 217 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 262 SLTRYARSFDCGERKWLT 279 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 104 SLTRYARSFDCGERKWLT 121 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 40 AALMNRPTRGERRFAYWAL 58 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 103 SLTRYARSFDCGERKWLT 120 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 341 AALMNRPTRGERRFAYWAL 359 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 404 SLTRYARSFDCGERKWLT 421 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 196 AALMNRPTRGERRFAYWAL 214 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 259 SLTRYARSFDCGERKWLT 276 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 96 AALMNRPTRGERRFAYWAL 114 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 159 SLTRYARSFDCGERKWLT 176 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 145 SLTRYARSFDCGERKWLT 162 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 559 AALMNRPTRGERRFAYWAL 577 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 622 SLTRYARSFDCGERKWLT 639 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 271 AALMNRPTRGERRFAYWAL 289 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 315 AALMNRPTRGERRFAYWAL 333 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 378 SLTRYARSFDCGERKWLT 395 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 108 SLTRYARSFDCGERKWLT 125 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 158 AALMNRPTRGERRFAYWAL 176 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 221 SLTRYARSFDCGERKWLT 238 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 116 AALMNRPTRGERRFAYWAL 134 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 179 SLTRYARSFDCGERKWLT 196 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 80 AALMNRPTRGERRFAYWAL 98 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 143 SLTRYARSFDCGERKWLT 160 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 42 AALMNRPTRGERRFAYWAL 60 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 105 SLTRYARSFDCGERKWLT 122 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 81 AALMNRPTRGERRFAYWAL 99 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 144 SLTRYARSFDCGERKWLT 161 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 476 AALMNRPTRGERRFAYWAL 494 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 73 AALMNRPTRGERRFAYWAL 91 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 36 AALMNRPTRGERRFAYWAL 54 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 127 AALMNRPTRGERRFAYWAL 145 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 190 SLTRYARSFDCGERKWLT 207 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 50 AALMNRPTRGERRFAYWAL 68 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 113 SLTRYARSFDCGERKWLT 130 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 85 AALMNRPTRGERRFAYWAL 103 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 148 SLTRYARSFDCGERKWLT 165 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 5505 AALMNRPTRGERRFAYWAL 5523 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 101 AALMNRPTRGERRFAYWAL 119 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 164 SLTRYARSFDCGERKWLT 181 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 188 AALMNRPTRGERRFAYWAL 206 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 11 AALMNRPTRGERRFAYWAL 29 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 74 SLTRYARSFDCGERKWLT 91 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 124 SLTRYARSFDCGERKWLT 141 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 548 AALMNRPTRGERRFAYWAL 566 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 611 SLTRYARSFDCGERKWLT 628 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 47 AALMNRPTRGERRFAYWAL 65 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 162 AALMNRPTRGERRFAYWAL 180 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 124 SLTRYARSFDCGERKWLT 141 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 648 AALMNRPTRGERRFAYWAL 666 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 119 AALMNRPTRGERRFAYWAL 137 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 182 SLTRYARSFDCGERKWLT 199 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 544 PLXEHHKIDAQVRXXETRQXYKDT 615 PL K DAQ+ ETRQ YKDT Sbjct: 157 PLTSITKSDAQISGGETRQDYKDT 180 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 108 SLTRYARSFDCGERKWLT 125 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 169 AALMNRPTRGERRFAYWAL 187 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 44 AALMNRPTRGERRFAYWAL 62 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 107 SLTRYARSFDCGERKWLT 124 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 65 AALMNRPTRGERRFAYWAL 83 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 128 SLTRYARSFDCGERKWLT 145 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 87 AALMNRPTRGERRFAYWAL 105 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 150 SLTRYARSFDCGERKWLT 167 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 127 SLTRYARSFDCGERKWLT 144 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 94 AALMNRPTRGERRFAYWAL 112 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 53 AALMNRPTRGERRFAYWAL 71 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 116 SLTRYARSFDCGERKWLT 133 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 88 SLTRYARSFDCGERKWLT 105 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 54 AALMNRPTRGERRFAYWAL 72 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 80 AALMNRPTRGERRFAYWAL 98 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 143 SLTRYARSFDCGERKWLT 160 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 357 AALMNRPTRGERRFAYWAL 375 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 78 AALMNRPTRGERRFAYWAL 96 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 141 SLTRYARSFDCGERKWLT 158 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 47 AALMNRPTRGERRFAYWAL 65 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 110 SLTRYARSFDCGERKWLT 127 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 185 AALMNRPTRGERRFAYWAL 203 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 248 SLTRYARSFDCGERKWLT 265 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 576 AALMNRPTRGERRFAYWAL 594 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 639 SLTRYARSFDCGERKWLT 656 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 298 AALMNRPTRGERRFAYWAL 316 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 361 SLTRYARSFDCGERKWLT 378 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 108 SLTRYARSFDCGERKWLT 125 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 71 AALMNRPTRGERRFAYWAL 89 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 134 SLTRYARSFDCGERKWLT 151 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 802 AALMNRPTRGERRFAYWAL 820 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 865 SLTRYARSFDCGERKWLT 882 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 581 AALMNRPTRGERRFAYWAL 599 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 137 AALMNRPTRGERRFAYWAL 155 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 187 AALMNRPTRGERRFAYWAL 205 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 250 SLTRYARSFDCGERKWLT 267 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 86 AALMNRPTRGERRFAYWAL 104 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 149 SLTRYARSFDCGERKWLT 166 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 216 AALMNRPTRGERRFAYWAL 234 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 487 AALMNRPTRGERRFAYWAL 505 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 550 SLTRYARSFDCGERKWLT 567 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 32 AALMNRPTRGERRFAYWAL 50 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 95 SLTRYARSFDCGERKWLT 112 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 145 AALMNRPTRGERRFAYWAL 163 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 932 AALMNRPTRGERRFAYWAL 950 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 995 SLTRYARSFDCGERKWLT 1012 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 58 AALMNRPTRGERRFAYWAL 76 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 121 SLTRYARSFDCGERKWLT 138 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 100 AALMNRPTRGERRFAYWAL 118 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 163 SLTRYARSFDCGERKWLT 180 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 437 AALMNRPTRGERRFAYWAL 455 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 500 SLTRYARSFDCGERKWLT 517 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 104 SLTRYARSFDCGERKWLT 121 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 44 AALMNRPTRGERRFAYWAL 62 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 70 AALMNRPTRGERRFAYWAL 88 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 133 SLTRYARSFDCGERKWLT 150 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 424 AALMNRPTRGERRFAYWAL 442 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 233 AALMNRPTRGERRFAYWAL 251 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 296 SLTRYARSFDCGERKWLT 313 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 240 AALMNRPTRGERRFAYWAL 258 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 200 AALMNRPTRGERRFAYWAL 218 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 143 AALMNRPTRGERRFAYWAL 161 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 36 AALMNRPTRGERRFAYWAL 54 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 40 AALMNRPTRGERRFAYWAL 58 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 752 AALMNRPTRGERRFAYWAL 770 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 115 SLTRYARSFDCGERKWLT 132 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 63 AALMNRPTRGERRFAYWAL 81 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 22 AALMNRPTRGERRFAYWAL 40 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 85 SLTRYARSFDCGERKWLT 102 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 117 AALMNRPTRGERRFAYWAL 135 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 205 SLTRYARSFDCGERKWLT 222 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 103 AALMNRPTRGERRFAYWAL 121 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 227 AALMNRPTRGERRFAYWAL 245 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 290 SLTRYARSFDCGERKWLT 307 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 53 AALMNRPTRGERRFAYWAL 71 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 116 SLTRYARSFDCGERKWLT 133 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 101 AALMNRPTRGERRFAYWAL 119 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 164 SLTRYARSFDCGERKWLT 181 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 136 AALMNRPTRGERRFAYWAL 154 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 124 SLTRYARSFDCGERKWLT 141 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 1681 AALMNRPTRGERRFAYWAL 1699 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 103 AALMNRPTRGERRFAYWAL 121 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 166 SLTRYARSFDCGERKWLT 183 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +2 Query: 290 SALMNRPTRGERRFAYWAL 346 +ALMNRPTRGERRFAYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 362 SLTRCARSFGCGERYQLT 415 SLTR ARSF CGER LT Sbjct: 71 SLTRYARSFDCGERKWLT 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,940,897 Number of Sequences: 59808 Number of extensions: 338707 Number of successful extensions: 2028 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2025 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -