BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D23 (917 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024801-9|AAF59653.3| 791|Caenorhabditis elegans Hypothetical ... 31 0.87 >AC024801-9|AAF59653.3| 791|Caenorhabditis elegans Hypothetical protein Y50D7A.1 protein. Length = 791 Score = 31.5 bits (68), Expect = 0.87 Identities = 19/110 (17%), Positives = 45/110 (40%) Frame = +2 Query: 143 ECSEKNALFVKFVMXXXXXXXXXAAINKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGE 322 ECS N F + ++ +L + + I F GE+W +F + Sbjct: 392 ECSMPNIEFHQIADVRNEKMIRLVSLGRLRSEVWSIFFFEKVGEIWSIFEHFRECGAFWK 451 Query: 323 RRFAYWALFRFLXSLTRCARSFGCGERYQLTQRR*YGYPQNQGITQERTC 472 + W++F+ + + +++ G ++ R+ P+N ++++ C Sbjct: 452 KFGKIWSIFKKVREIWSISKTAGKPQKLCFFFRKKGQKPENIDFSKKKLC 501 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,535,785 Number of Sequences: 27780 Number of extensions: 253465 Number of successful extensions: 483 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2349764032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -