BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D20 (952 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 32 0.77 03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417,173... 27 1.3 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.3 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.8 08_02_0248 - 14757365-14757426,14758550-14758991 25 1.9 04_01_0034 - 401208-402923 30 2.4 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 2.4 03_02_0342 - 7645323-7645909,7646323-7646491 26 2.4 05_04_0011 + 17139322-17139451,17139552-17140174 27 3.1 08_02_0937 + 22801526-22802461 30 3.1 12_02_1174 - 26696869-26698191 29 3.8 02_01_0016 + 110796-110979,111252-111768,111847-112213 25 3.8 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 4.1 07_01_0080 + 587674-588510 29 4.1 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 4.1 01_05_0490 + 22672241-22674679 24 4.6 05_01_0131 + 888247-888771,889092-889154 24 5.3 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 5.4 08_02_1081 + 24215323-24215335,24215450-24215572,24216241-242164... 29 5.4 02_05_0002 - 24849189-24849825,24850267-24850328 29 5.4 01_05_0798 - 25322213-25322333,25322536-25322816 29 5.4 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 7.2 09_01_0016 - 376742-376883,377973-378964 29 7.2 08_02_0193 - 14073103-14073246,14073332-14073481,14073571-140736... 29 7.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 7.2 07_03_1381 - 26166673-26166747,26166972-26167544 29 7.2 07_01_0862 - 7172083-7172931 29 7.2 12_02_0299 - 17051570-17052474,17053542-17053755 28 9.5 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 28 9.5 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 28 9.5 07_03_1382 - 26170563-26170631,26171151-26171843 28 9.5 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 28 9.5 07_01_0176 - 1244704-1245102 28 9.5 04_01_0354 - 4646826-4647314 28 9.5 02_05_1269 + 35352825-35352888,35353645-35353968,35355062-353551... 28 9.5 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 28 9.5 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 9.5 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.9 bits (69), Expect = 0.77 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 569 PPPPXGXGGXGGPP 610 PPPP G GG GGPP Sbjct: 1186 PPPPRGHGGVGGPP 1199 >03_01_0219 + 1731267-1731728,1732148-1732235,1732330-1732417, 1732528-1732573,1732687-1732785,1734363-1734431, 1735706-1736036,1736123-1736256,1736400-1737251 Length = 722 Score = 27.5 bits (58), Expect(2) = 1.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 798 KKXXXXXPPPPPPPP 754 +K PPPPPPPP Sbjct: 5 RKAAAAPPPPPPPPP 19 Score = 22.2 bits (45), Expect(2) = 1.3 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -2 Query: 771 PPPPPPXXXXXXXXXXXXKKK 709 PPPPPP KKK Sbjct: 11 PPPPPPPPPAETPARRKGKKK 31 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP K PPPPPPP Sbjct: 551 PPPPSGNKPAFSPPPPPPPP 570 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P P K PPPPPPPP Sbjct: 552 PPPSGNKPAFSPPPPPPPPPP 572 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 572 PPPLPQSNYASSQPPPPPPP 591 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 589 PPPPPLPNCLVPSPPPPPPP 608 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 607 PPPPILPNRSVPPPPPPPPP 626 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 622 PPPPPLPNHSVLPPPPPPPP 641 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 623 PPPPLPNHSVLPPPPPPPPP 642 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 624 PPPLPNHSVLPPPPPPPPPP 643 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 550 PPPPPSGNKPAFSPPPPPPP 569 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP K PPPPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPP 332 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PPPPXGXGGXGGPPP 613 PPPP G GGPPP Sbjct: 365 PPPPPPGGKKGGPPP 379 >08_02_0248 - 14757365-14757426,14758550-14758991 Length = 167 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -1 Query: 778 PPPPPPPXXXXXXXXXXXXKXKKKK 704 PPPPPPP K KK+ Sbjct: 45 PPPPPPPLMPAGGEVTGGSKAAKKR 69 Score = 24.2 bits (50), Expect(2) = 1.9 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 814 PPXXXKKXXXXXPPPPPP 761 PP ++ PPPPPP Sbjct: 34 PPLQLQQLHTTPPPPPPP 51 >04_01_0034 - 401208-402923 Length = 571 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP ++ PPPPPPP Sbjct: 309 PPPPQQQRAKPSRPPPPPPP 328 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP K PPPPPPP Sbjct: 360 PPPPPPKLNTAPKPPPPPPP 379 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 831 KKXXXPXPXXXKKXXXXXPPPPPPPP 754 K+ P P + PPPPPPPP Sbjct: 333 KQVTSPSPRPVQPSNAPPPPPPPPPP 358 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P P PPPPPPPP Sbjct: 340 PRPVQPSNAPPPPPPPPPPPP 360 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 362 PPPPKLNTAPKPPPPPPPPP 381 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 25.8 bits (54), Expect(2) = 2.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 Query: 798 KKXXXXXPPPPPPP 757 KK PPPPPPP Sbjct: 166 KKKFMFAPPPPPPP 179 Score = 23.0 bits (47), Expect(2) = 2.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 777 PPPPPPPP 754 PPPPP PP Sbjct: 175 PPPPPRPP 182 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 26.6 bits (56), Expect(2) = 3.1 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 777 PPPPPPPP 754 PPPPPPPP Sbjct: 103 PPPPPPPP 110 Score = 21.8 bits (44), Expect(2) = 3.1 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPP 757 P P + PPPP PP Sbjct: 58 PNPVHNEFQPPPPPPPPSPP 77 >08_02_0937 + 22801526-22802461 Length = 311 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP ++ PPPPPPP Sbjct: 60 PPPEPEEEEEVSSPPPPPPP 79 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP + PPPPPPP Sbjct: 141 PPPVKPQPPPSLPPPPPPPP 160 Score = 24.6 bits (51), Expect(2) = 3.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPP 757 P P PPPPPPP Sbjct: 146 PQPPPSLPPPPPPPPPPPPP 165 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 777 PPPPPPPP 754 P PPPPPP Sbjct: 188 PSPPPPPP 195 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 24.6 bits (51), Expect(2) = 3.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPP 757 P P PPPPPPP Sbjct: 205 PTPPSLPVDTMPPPPPPPPP 224 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 777 PPPPPPPP 754 PPPPPP P Sbjct: 219 PPPPPPQP 226 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP + PPPPPPP Sbjct: 257 PPPQSVRPPPPPPPPPPPPP 276 >07_01_0080 + 587674-588510 Length = 278 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 832 KKXXXPPPXXXKKXXXXXPPPPPPP 758 ++ PPP PPPPPPP Sbjct: 89 RRPPPPPPPPPSSGSPPPPPPPPPP 113 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 97 PPPSSGSPPPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 96 PPPPSSGSPPPPPPPPPPPP 115 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP + PPPPPPP Sbjct: 39 PPPARHRAPSPPRPPPPPPP 58 >01_05_0490 + 22672241-22674679 Length = 812 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 777 PPPPPPP 757 PPPPPPP Sbjct: 641 PPPPPPP 647 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 774 PPPPPPP 754 PPPPPPP Sbjct: 664 PPPPPPP 670 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 777 PPPPPPP 757 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 Query: 774 PPPPPPP 754 PPPPPPP Sbjct: 160 PPPPPPP 166 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 336 PPPSRFNNTTPKPPPPPPPP 355 >08_02_1081 + 24215323-24215335,24215450-24215572,24216241-24216489, 24218517-24218720,24218864-24218993,24219610-24219679, 24219766-24219900,24219996-24220209,24220314-24220455, 24220630-24220851,24220997-24221195 Length = 566 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 810 PXXXKKXXXXXPPPPPPPP 754 P K+ PPPPPPPP Sbjct: 56 PQVEKRADQTPPPPPPPPP 74 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 29.1 bits (62), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 834 KKKXXXPXPXXXKKXXXXXPPPPPPPP 754 KKK P P PPPPPPP Sbjct: 198 KKKRKKPQPADTSGGGGHPHPPPPPPP 224 >01_05_0798 - 25322213-25322333,25322536-25322816 Length = 133 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P KK PPPPPPPP Sbjct: 15 PHGTPTKKAPLVAPPPPPPPP 35 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 74 PPPQTPPSPPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPP 92 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -2 Query: 798 KKXXXXXPPPPPPPP 754 KK PPPPPPPP Sbjct: 53 KKAPFVAPPPPPPPP 67 >08_02_0193 - 14073103-14073246,14073332-14073481,14073571-14073640, 14073900-14074021,14074260-14074395,14074492-14074967 Length = 365 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP + PPPPPPP Sbjct: 52 PPPPPLCRRRRSWPPPPPPP 71 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 108 PPPPPPPSPPPSAPPPPPPP 127 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 109 PPPPPPSPPPSAPPPPPPPP 128 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 95 PPPPYGVNSSQPPPPPPPPP 114 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 151 PPPCGDANENPPPPPPPPPP 170 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 834 KKKXXXPXPXXXKKXXXXXPPPPPPPP 754 KK P P KK P PPP PP Sbjct: 167 KKPLLYPPPLPPKKKPLPPPSPPPQPP 193 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P P PPPPPPPP Sbjct: 312 PLPSFYPSPPPPPPPPPPPPP 332 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PPPPXGXGGXGGPPP 613 PPPP G GGPPP Sbjct: 624 PPPPPPPGKPGGPPP 638 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PPPPXGXGGXGGPPP 613 PPPP G GGPPP Sbjct: 929 PPPPPPPGKPGGPPP 943 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 187 PPPPQPSGDANENPPPPPPP 206 >07_03_1090 + 23891294-23892222,23892317-23892516,23895241-23895482, 23895771-23896461,23896486-23896562 Length = 712 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P P PPPPPPPP Sbjct: 211 PAPPQTNPPRPVRPPPPPPPP 231 >07_01_0176 - 1244704-1245102 Length = 132 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 759 GGGGGGGXXSXXFFXXXGGG 818 GGGGGGG +F GGG Sbjct: 41 GGGGGGGFFEVPWFGPPGGG 60 >04_01_0354 - 4646826-4647314 Length = 162 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 816 PXPXXXKKXXXXXPPPPPPPP 754 P P PPPPPPPP Sbjct: 81 PRPHPLPNLNLSPPPPPPPPP 101 >02_05_1269 + 35352825-35352888,35353645-35353968,35355062-35355183, 35355361-35355482,35355651-35355755,35356402-35356765, 35357181-35357321,35357619-35359109 Length = 910 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 Query: 392 WGGXFXXXPGXXGGAXXFFXCPXXKKKKXXPXXXGGG 502 W G GGA +F CP K+ P G G Sbjct: 811 WSSVSSSSDGGEGGAPSYFVCPILKEVMRDPQIAGDG 847 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 360 PPPPPPPPPPPPRPPPPPPP 379 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 412 PPPPPTHTHGPPPPPPPPPP 431 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -1 Query: 817 PPPXXXKKXXXXXPPPPPPP 758 PPP PPPPPPP Sbjct: 413 PPPPTHTHGPPPPPPPPPPP 432 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,606,346 Number of Sequences: 37544 Number of extensions: 582610 Number of successful extensions: 24487 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 3097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10383 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2741249160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -