BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D18 (949 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 2.5 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 3.3 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 24 5.8 DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. 24 5.8 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 5.8 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 25.4 bits (53), Expect = 2.5 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 272 KARAPSSRNVVNNLIIDKXRNTMEYCYKLWVG-NGQEIVRKYFPL 403 +AR S ++N I+ + RN+ME+C G G +VR+ P+ Sbjct: 77 RARLKRS-GLLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.0 bits (52), Expect = 3.3 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 440 DHLQKLQPRSEARFHNQSLE*EELPTAMV*TSIL 541 DH+ +L PR + R+H+ S + PT + T++L Sbjct: 445 DHVCELLPRLQPRYHSISSSSKLHPTTVHVTAVL 478 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 24.2 bits (50), Expect = 5.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 750 RTSFSYLAGWKNHCS 706 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >DQ007317-1|AAY24699.1| 140|Anopheles gambiae lysozyme c-1 protein. Length = 140 Score = 24.2 bits (50), Expect = 5.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 750 RTSFSYLAGWKNHCS 706 R F+ GWKNHC+ Sbjct: 115 RHGFNAWYGWKNHCN 129 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 5.8 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = +2 Query: 80 LAKAPHXMXLLVWSLALVHGSPPARASLHSPRTLLTK 190 L+ PH + + + +VH +LH PRT +++ Sbjct: 817 LSWVPHVKEITLKATRIVHAVNRLMPNLHGPRTSMSR 853 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 801,723 Number of Sequences: 2352 Number of extensions: 14271 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 103776201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -