BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D15 (932 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99942-7|CAB17070.2| 462|Caenorhabditis elegans Hypothetical pr... 28 8.3 Z71177-1|CAA94865.3| 355|Caenorhabditis elegans Hypothetical pr... 28 8.3 >Z99942-7|CAB17070.2| 462|Caenorhabditis elegans Hypothetical protein H13N06.5 protein. Length = 462 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 869 SVXVYPTLAPTSSKFQTILPLFY*LLKIFMLY 774 +V V P L SS FQT+ +F L IF++Y Sbjct: 425 TVSVIPELLENSSFFQTVKEIFAILTGIFLMY 456 >Z71177-1|CAA94865.3| 355|Caenorhabditis elegans Hypothetical protein AC3.1 protein. Length = 355 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 762 YCCDNYFYCIFVLAAKQYPCISISLFGLTITSFV*YVFLTLTI-PTLSD 619 Y DN YCI + YP I+ SL L++ + V L ++ P L D Sbjct: 139 YLLDNVTYCIVIFLLNIYPVIAASLLYLSMLNKSEQVELVKSVYPNLVD 187 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,236,630 Number of Sequences: 27780 Number of extensions: 348849 Number of successful extensions: 804 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 782 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 804 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2402214122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -