BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D13 (970 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC012062-1|AAH12062.1| 407|Homo sapiens DAZ associated protein ... 31 6.3 AY675556-1|AAV91783.1| 474|Homo sapiens myocyte enhancer factor... 31 6.3 AK056850-1|BAB71295.1| 289|Homo sapiens protein ( Homo sapiens ... 31 6.3 AF181719-1|AAF78364.1| 407|Homo sapiens DAZ associated protein ... 31 6.3 >BC012062-1|AAH12062.1| 407|Homo sapiens DAZ associated protein 1 protein. Length = 407 Score = 31.1 bits (67), Expect = 6.3 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 279 PPPXPXFXGXXXXTPPGGFFXPXKXVPXXXFFXXFFF---XXXPXXNXLXXXGPPPP 440 PPP P F TPPGGF P F F P + G PPP Sbjct: 256 PPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPP 312 >AY675556-1|AAV91783.1| 474|Homo sapiens myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusion p protein. Length = 474 Score = 31.1 bits (67), Expect = 6.3 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 279 PPPXPXFXGXXXXTPPGGFFXPXKXVPXXXFFXXFFF---XXXPXXNXLXXXGPPPP 440 PPP P F TPPGGF P F F P + G PPP Sbjct: 323 PPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPP 379 >AK056850-1|BAB71295.1| 289|Homo sapiens protein ( Homo sapiens cDNA FLJ32288 fis, clone PROST2000325, highly similar to Homo sapiens DAZ associated protein 1 (DAZAP1) mRNA. ). Length = 289 Score = 31.1 bits (67), Expect = 6.3 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 279 PPPXPXFXGXXXXTPPGGFFXPXKXVPXXXFFXXFFF---XXXPXXNXLXXXGPPPP 440 PPP P F TPPGGF P F F P + G PPP Sbjct: 167 PPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPP 223 >AF181719-1|AAF78364.1| 407|Homo sapiens DAZ associated protein 1 protein. Length = 407 Score = 31.1 bits (67), Expect = 6.3 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 279 PPPXPXFXGXXXXTPPGGFFXPXKXVPXXXFFXXFFF---XXXPXXNXLXXXGPPPP 440 PPP P F TPPGGF P F F P + G PPP Sbjct: 256 PPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPP 312 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,485,589 Number of Sequences: 237096 Number of extensions: 2327907 Number of successful extensions: 20395 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15166 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12880737904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -