BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D12 (887 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 28 1.5 SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces... 27 2.7 SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pomb... 27 4.7 SPCPJ732.02c |||xylulose kinase |Schizosaccharomyces pombe|chr 3... 27 4.7 SPAPB21F2.03 |||ribosome biogenesis protein |Schizosaccharomyces... 26 6.2 SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomy... 26 6.2 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -1 Query: 299 PAFPKSPSSFCPKVPKTLPPPICLSQVTSRGCR 201 P+ P PS+ P PK PPP+ + V + R Sbjct: 185 PSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSR 217 >SPAC19D5.01 |pyp2||tyrosine phosphatase Pyp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 711 Score = 27.5 bits (58), Expect = 2.7 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 290 PKSPS-SFCPKVPKTLPPPICLSQVTS 213 P SP SF +VP +PPP+C V S Sbjct: 165 PISPDYSFPLRVPINIPPPLCTPSVVS 191 >SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pombe|chr 3|||Manual Length = 476 Score = 26.6 bits (56), Expect = 4.7 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 244 GKVFGTLGQNDDGLFGKAGYNR-EIFNDDRGKLTGQAYGTRVLGPGGDSTNYG 399 GK G +G + D + +R F RG +Y TRV G GG T+YG Sbjct: 166 GKFIG-VGSDGDSRISTSSKSRFPSFGSSRG-----SYRTRVYGDGGGFTDYG 212 >SPCPJ732.02c |||xylulose kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 555 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 107 ISSLQLWCVLTQKFTDLLITRKITRSAGNPQGDTLVTSLGTNKWGEARSL 256 + + LW + +KF D+ + ++ AGN +G L LGT + A+ L Sbjct: 204 VCGMNLWDIQNEKF-DIRLLEEV---AGNSKGPDLANKLGTVEINGAKHL 249 >SPAPB21F2.03 |||ribosome biogenesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 26.2 bits (55), Expect = 6.2 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -1 Query: 335 LPRSSLKISLL*PAFPKSPSSFCPKVPKTLPPPICLSQVTSRGCRLEDCPLIE 177 +P++ ++SL A + PSS P ++P S VTS L + PL E Sbjct: 1 MPKAKKRVSLASKASSRLPSSGKPSQQASIPNVELSSTVTSNSQVLNNDPLKE 53 >SPAC1002.14 |itt1||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 435 Score = 26.2 bits (55), Expect = 6.2 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 531 AEKWVFLSRSHTPEPDAVIPDLPPICLFRSIVACAFLF 418 AEKWV L+ P D V+ + C + F F Sbjct: 357 AEKWVLLNGQRCPTCDRVVERIDGCCHMNCLCGTHFCF 394 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,130,430 Number of Sequences: 5004 Number of extensions: 63951 Number of successful extensions: 131 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -