BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D12 (887 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 25 0.92 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 8.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 8.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 8.6 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 25.0 bits (52), Expect = 0.92 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +1 Query: 301 YNREIFNDDRGKLTGQAYGTRVLGPGGDSTNYGGRLDWGEQ 423 Y + ++ D+ +TG AYG + PG S + G ++G++ Sbjct: 60 YKQRVY--DKNGMTGDAYGGLNIRPGQPSRQHAG-FEFGKE 97 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 144 FCVNTHQSCSEDIKQIXIHFE 82 + VNT Q + D +Q IH+E Sbjct: 276 YYVNTEQFRTSDYQQNDIHYE 296 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 144 FCVNTHQSCSEDIKQIXIHFE 82 + VNT Q + D +Q IH+E Sbjct: 276 YYVNTEQFRTSDYQQNDIHYE 296 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 144 FCVNTHQSCSEDIKQIXIHFE 82 + VNT Q + D +Q IH+E Sbjct: 276 YYVNTEQFRTSDYQQNDIHYE 296 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,817 Number of Sequences: 438 Number of extensions: 4632 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -