BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D11 (895 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113525-1|AAM29530.1| 79|Drosophila melanogaster RE60462p pro... 84 3e-16 AE014298-991|AAF46232.3| 79|Drosophila melanogaster CG32736-PB... 84 3e-16 AE014298-990|AAF46233.2| 79|Drosophila melanogaster CG32736-PA... 84 3e-16 >AY113525-1|AAM29530.1| 79|Drosophila melanogaster RE60462p protein. Length = 79 Score = 83.8 bits (198), Expect = 3e-16 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +1 Query: 133 KNLLINGLEKGLLGIYRFLPIFFLLGASLEFSMINWKVGEVNFYNTFKKRQARDLIEEK 309 + LL + K G+YRFLP+FFLLGA LEFSMINW VGE NFY TFK+RQA++ +EE+ Sbjct: 9 RRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQAKNYVEEQ 67 Score = 30.3 bits (65), Expect = 3.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 129 IQKLVNKWPGKRAFGNL*VSPYFFL 203 +++L++ WPGK+ FG P FFL Sbjct: 8 VRRLLDSWPGKKRFGVYRFLPLFFL 32 >AE014298-991|AAF46232.3| 79|Drosophila melanogaster CG32736-PB, isoform B protein. Length = 79 Score = 83.8 bits (198), Expect = 3e-16 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +1 Query: 133 KNLLINGLEKGLLGIYRFLPIFFLLGASLEFSMINWKVGEVNFYNTFKKRQARDLIEEK 309 + LL + K G+YRFLP+FFLLGA LEFSMINW VGE NFY TFK+RQA++ +EE+ Sbjct: 9 RRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQAKNYVEEQ 67 Score = 30.3 bits (65), Expect = 3.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 129 IQKLVNKWPGKRAFGNL*VSPYFFL 203 +++L++ WPGK+ FG P FFL Sbjct: 8 VRRLLDSWPGKKRFGVYRFLPLFFL 32 >AE014298-990|AAF46233.2| 79|Drosophila melanogaster CG32736-PA, isoform A protein. Length = 79 Score = 83.8 bits (198), Expect = 3e-16 Identities = 37/59 (62%), Positives = 46/59 (77%) Frame = +1 Query: 133 KNLLINGLEKGLLGIYRFLPIFFLLGASLEFSMINWKVGEVNFYNTFKKRQARDLIEEK 309 + LL + K G+YRFLP+FFLLGA LEFSMINW VGE NFY TFK+RQA++ +EE+ Sbjct: 9 RRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQAKNYVEEQ 67 Score = 30.3 bits (65), Expect = 3.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 129 IQKLVNKWPGKRAFGNL*VSPYFFL 203 +++L++ WPGK+ FG P FFL Sbjct: 8 VRRLLDSWPGKKRFGVYRFLPLFFL 32 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,993,310 Number of Sequences: 53049 Number of extensions: 447405 Number of successful extensions: 954 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4341591036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -