BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D08 (867 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82068-6|CAB04901.1| 1829|Caenorhabditis elegans Hypothetical pr... 29 3.3 AL032655-10|CAA21727.1| 1829|Caenorhabditis elegans Hypothetical... 29 3.3 U51999-7|AAA96089.1| 89|Caenorhabditis elegans Helix loop heli... 29 5.7 AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical ... 28 9.9 >Z82068-6|CAB04901.1| 1829|Caenorhabditis elegans Hypothetical protein Y6B3B.1 protein. Length = 1829 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 4/75 (5%) Frame = -2 Query: 710 FPEREKGGXGIR*AAGSEQESARGSFQGETPGIF--IVLSGF--ATSDLSVDFCDARQGG 543 FP R G +R +GS + S G+F G F V SG +S S+ FC+ Sbjct: 169 FPLRSSGSSSVRPGSGSVKRSGSGTFHGTPASAFGDSVGSGLQPGSSTGSLRFCNFSGIS 228 Query: 542 GAYGKTPATRPFYGS 498 G R F GS Sbjct: 229 ALPGSLELFRNFPGS 243 >AL032655-10|CAA21727.1| 1829|Caenorhabditis elegans Hypothetical protein Y6B3B.1 protein. Length = 1829 Score = 29.5 bits (63), Expect = 3.3 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 4/75 (5%) Frame = -2 Query: 710 FPEREKGGXGIR*AAGSEQESARGSFQGETPGIF--IVLSGF--ATSDLSVDFCDARQGG 543 FP R G +R +GS + S G+F G F V SG +S S+ FC+ Sbjct: 169 FPLRSSGSSSVRPGSGSVKRSGSGTFHGTPASAFGDSVGSGLQPGSSTGSLRFCNFSGIS 228 Query: 542 GAYGKTPATRPFYGS 498 G R F GS Sbjct: 229 ALPGSLELFRNFPGS 243 >U51999-7|AAA96089.1| 89|Caenorhabditis elegans Helix loop helix protein 15 protein. Length = 89 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +2 Query: 554 EHHKNRRSSQRWRNPTGL*---RYQAFPPGSSLVRSPVPTLPLTGYLXRLSPFRESVA 718 E K RR++ ++RN R ++F S +R+ +PTLP+ L ++ R S+A Sbjct: 22 ERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKKLSKIEILRFSIA 79 >AL034393-1|CAA22308.1| 1634|Caenorhabditis elegans Hypothetical protein Y18D10A.1 protein. Length = 1634 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -2 Query: 776 LGANDLHRTEIPXSVSYEKAPRFPEREKGGXGIR*AAGSEQESARGSFQGE 624 L + +HR + P S A ER+K G + AAG+ + + S G+ Sbjct: 352 LNSTKIHRNQFPTSDFETIAQATAERKKALLGAQGAAGASEPGSSSSIHGK 402 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,037,501 Number of Sequences: 27780 Number of extensions: 364728 Number of successful extensions: 939 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2171433726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -