BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D06 (917 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1347.08c |||ribonuclease H2 complex subunit|Schizosaccharomy... 26 6.5 SPAC4D7.10c |||SAGA complex subunit Spt20 |Schizosaccharomyces p... 26 8.6 >SPBC1347.08c |||ribonuclease H2 complex subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 26.2 bits (55), Expect = 6.5 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 475 SCRLWRSMLFCRNIQNLWHNRTA*TARWLLP-SFFRKRFENSKFLGKESDLVHHS 314 SC+ + L C ++Q W+N+ A L P + K E S+ + E + + +S Sbjct: 195 SCKWHAASLVCEDLQPEWYNKLAYWQEELAPLHAYTKNLEESRKILVEKEALLNS 249 >SPAC4D7.10c |||SAGA complex subunit Spt20 |Schizosaccharomyces pombe|chr 1|||Manual Length = 473 Score = 25.8 bits (54), Expect = 8.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 635 LERENML*LRNYQRKRTIRNVRQLFQF 715 LE+EN+L L + QRKR + Q QF Sbjct: 266 LEKENLLLLMDDQRKRDFQPTFQRLQF 292 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,103,391 Number of Sequences: 5004 Number of extensions: 58064 Number of successful extensions: 152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 152 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -