BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D04 (910 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 27 1.0 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 4.2 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 23 9.7 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 9.7 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 9.7 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 26.6 bits (56), Expect = 1.0 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = -3 Query: 701 PTNGDISVTFASAQAIAWYKENNSVRLQ*FHASSPTLGCLNPSQVEA 561 P N ++ + SA W E L FH P L NP+ V+A Sbjct: 156 PPNNWVAAWYGSAWE--WNDERKQFYLHQFHKKQPDLNYRNPAVVQA 200 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 4.2 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +3 Query: 279 CCWVWKQYQ 305 CCWVW ++Q Sbjct: 790 CCWVWLKFQ 798 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.4 bits (48), Expect = 9.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 210 GEFEAMKEYKAYRCYYKSK 266 GE K + Y+CY+K+K Sbjct: 109 GETACDKAFSLYQCYHKNK 127 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.4 bits (48), Expect = 9.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 841 GKMHPLLGSCNQTSCNXCKFLSRKLLRGLPGP 746 G P +C C K + K RGLPGP Sbjct: 79 GPQGPPGKNCTSGGCCLPKCFAEKGNRGLPGP 110 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.4 bits (48), Expect = 9.7 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 646 YQAIACAEANVTLISPFVGRILDWYVEHTKKTYEGQEDPGVVSVT 780 +QAIA A + + RI+ Y + + YE E P V SVT Sbjct: 580 WQAIATA-LRTKRVPAGLQRIIHSYFQDRELVYETSEGPVVRSVT 623 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 906,215 Number of Sequences: 2352 Number of extensions: 18863 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98401338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -