BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D03 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 68 2e-12 SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 67 3e-12 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 63 6e-11 SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 30 0.50 SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosacchar... 27 4.7 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 68.1 bits (159), Expect = 2e-12 Identities = 33/73 (45%), Positives = 51/73 (69%) Frame = +2 Query: 140 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 319 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 320 KHRLWSGCCSGPL 358 + SG + P+ Sbjct: 61 --NIGSGAGAAPV 71 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 67.3 bits (157), Expect = 3e-12 Identities = 30/59 (50%), Positives = 45/59 (76%) Frame = +2 Query: 140 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 316 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELL 59 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 62.9 bits (146), Expect = 6e-11 Identities = 27/59 (45%), Positives = 44/59 (74%) Frame = +2 Query: 140 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 316 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELL 59 >SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 29.9 bits (64), Expect = 0.50 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 40 LRLLVSLCLSETQTCLFSLELRATAT-CTFKTKNGV 144 +RLL LC S Q CLFS L AT C + K+ V Sbjct: 447 MRLLTDLCKSPAQKCLFSNLLTATRKFCLERQKDDV 482 >SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosaccharomyces pombe|chr 1|||Manual Length = 186 Score = 26.6 bits (56), Expect = 4.7 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = +2 Query: 122 RSKLKMVSKAELACVYSALILVD-DDV--AVTGEKISTILKAAAVDVEPYWPGLFAKALE 292 R+ L+ + E S L+L + DV A++ E+IS IL + +W AL Sbjct: 103 RNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYK-SSHWRIFSVSALT 161 Query: 293 GINVRDLIT 319 G+N++D I+ Sbjct: 162 GLNIKDAIS 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,033,610 Number of Sequences: 5004 Number of extensions: 32440 Number of successful extensions: 93 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -