BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_D01 (923 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein ... 24 5.7 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 5.7 >CR954257-4|CAJ14155.1| 196|Anopheles gambiae predicted protein protein. Length = 196 Score = 24.2 bits (50), Expect = 5.7 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 338 PTNCGSGRVRKSSNTTSLXQFRQVLSESNVKII 436 P C G+VR + L Q Q+ +N+K++ Sbjct: 130 PNQCADGKVRFMNVCAVLNQEHQLCHLANIKLV 162 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.2 bits (50), Expect = 5.7 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 264 LFLEQQNQRNSRVVIGSGDSIDEPRFRSGRSGQNVNVQVNKTGAG 130 +FL Q S V +GDS+ + F + G+ + +V K AG Sbjct: 190 IFLRQATLEESLVDPKTGDSVHKIVFVAFFQGEQLKARVKKVCAG 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,570 Number of Sequences: 2352 Number of extensions: 15623 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100468593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -