BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C21 (1012 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.11 |atp17||F0 ATPase subunit F|Schizosaccharomyces pomb... 29 1.0 SPAC18G6.02c |chp1||chromodomain protein Chp1|Schizosaccharomyce... 26 9.7 >SPBC1604.11 |atp17||F0 ATPase subunit F|Schizosaccharomyces pombe|chr 2|||Manual Length = 96 Score = 29.1 bits (62), Expect = 1.0 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 424 SRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYAIN-YGRIXHHKXY 564 S +++ W +K K AP L+ +VF YA Y I HH+ + Sbjct: 49 SNSFFSWYYKKYLGKNASGAPLLHLVGAVLVFSYASEYYYHIRHHEEH 96 >SPAC18G6.02c |chp1||chromodomain protein Chp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 960 Score = 25.8 bits (54), Expect = 9.7 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +3 Query: 318 TMENLILPFSPVEAERNRFVVRSPQQDSVCRGRSFQSSLVEMA 446 T ++++ F+ ++ F ++SP++D VC Q +E A Sbjct: 323 TKQDILSYFAFIKGNIEVFFLKSPKKDKVCNMAYIQFDSIEQA 365 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,804,881 Number of Sequences: 5004 Number of extensions: 46535 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 525259918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -