BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C21 (1012 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0385 + 17167174-17167440,17173321-17173962 30 2.6 02_05_0516 + 29694631-29695182 30 2.6 02_01_0188 - 1262908-1262970,1264185-1264790,1265290-1266030 29 7.8 >09_04_0385 + 17167174-17167440,17173321-17173962 Length = 302 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -2 Query: 447 LPSPPGSTESSGHGRRSLAAATEPRTD 367 LP P +T SSG+ R S +A++ PR D Sbjct: 146 LPPEPSATTSSGNDRSSSSASSPPRAD 172 >02_05_0516 + 29694631-29695182 Length = 183 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = +1 Query: 376 WFGRRSKT-PS--AVAGAFSRAWWRWQHKYVQXKKVGMA 483 W RRSK+ PS A AG + WW W ++ KK G A Sbjct: 67 WAFRRSKSAPSLGAFAGGPLKRWWDWGVGWLMSKKPGFA 105 >02_01_0188 - 1262908-1262970,1264185-1264790,1265290-1266030 Length = 469 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -2 Query: 486 WSHANLLXLYVLMLPSPPGSTESSGHGRRSLAAATEPRTDFVQLQLG*MGV 334 W + YV+ + + S GH + + AA +P D ++ LG +GV Sbjct: 194 WGKGGAVHEYVVGMRIVTPAPASEGHAKVRVLAAGDPELDAAKVSLGVLGV 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,443,202 Number of Sequences: 37544 Number of extensions: 340687 Number of successful extensions: 792 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2975543960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -