BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C21 (1012 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. 61 7e-09 CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. 61 7e-09 AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase compl... 61 7e-09 AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subuni... 61 7e-09 AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transp... 60 9e-09 BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transp... 60 2e-08 BC112918-1|AAI12919.1| 415|Homo sapiens SOLH protein protein. 32 3.8 >CR542155-1|CAG46952.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 60.9 bits (141), Expect = 7e-09 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >CR456891-1|CAG33172.1| 94|Homo sapiens ATP5J2 protein. Length = 94 Score = 60.9 bits (141), Expect = 7e-09 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AY046911-1|AAL06647.1| 88|Homo sapiens F1Fo-ATP synthase complex Fo membrane domain f subunit protein. Length = 88 Score = 60.9 bits (141), Expect = 7e-09 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 14 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 73 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 74 FSYKHLKHERLRKYH 88 >AF088918-1|AAC34895.1| 94|Homo sapiens F1F0-type ATPase subunit f protein. Length = 94 Score = 60.9 bits (141), Expect = 7e-09 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >AK223348-1|BAD97068.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f isoform 2a v protein. Length = 94 Score = 60.5 bits (140), Expect = 9e-09 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 20 EVKLGELPSWVLMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >BC003678-1|AAH03678.1| 94|Homo sapiens ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 protein. Length = 94 Score = 59.7 bits (138), Expect = 2e-08 Identities = 25/75 (33%), Positives = 44/75 (58%) Frame = +1 Query: 349 QLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQXKKVGMAPFYQLLVGSMVFFYA 528 ++KL E+ SW R +PS + GAF R ++R+ +KY+ KK ++ +L ++F Y+ Sbjct: 20 EVKLLELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYS 79 Query: 529 INYGRIXHHKXYKYH 573 +Y + H + KYH Sbjct: 80 FSYKHLKHERLRKYH 94 >BC112918-1|AAI12919.1| 415|Homo sapiens SOLH protein protein. Length = 415 Score = 31.9 bits (69), Expect = 3.8 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = -2 Query: 444 PSPPGSTESSGHGRRSLAAATEPRTDFVQLQLG*MGVSGFP 322 P PPG + G G SL A PR VQL+ G G G P Sbjct: 354 PCPPG-LQPLGRGPESLPRAAGPRAGCVQLEAGHGGARGSP 393 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,802,973 Number of Sequences: 237096 Number of extensions: 1964969 Number of successful extensions: 3042 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3042 length of database: 76,859,062 effective HSP length: 91 effective length of database: 55,283,326 effective search space used: 13544414870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -