BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C17 (1081 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizos... 29 1.5 SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 26 7.9 >SPAC22F8.11 |plc1||phosphoinositide phospholipase C Plc1|Schizosaccharomyces pombe|chr 1|||Manual Length = 899 Score = 28.7 bits (61), Expect = 1.5 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +1 Query: 307 LESLKAXNLAVTLFGKNLALPKGEPWGPNFKNWFPWKKTRKNLERKAQ 450 LE LK L + G NL +GE +N PW+K K E+ AQ Sbjct: 268 LEGLKTYRLNEFIIGLNLVCHQGEKMIDYSENLNPWEKLEK--EQSAQ 313 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 26.2 bits (55), Expect = 7.9 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 289 KEQKVPLES---LKAXNLAVTLFGKNLALPKGEPWGPNFKNWF 408 KE+K+P + K L +T+F +N L + P+ N +WF Sbjct: 539 KEKKIPKKLPFWKKYLELQLTMFRQNNMLTEFHPYSSNPSDWF 581 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,975,917 Number of Sequences: 5004 Number of extensions: 78343 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 74 effective length of database: 1,992,182 effective search space used: 567771870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -