BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C17 (1081 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 3.9 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 9.0 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.0 bits (52), Expect = 3.9 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -3 Query: 455 GLWAFLS--KFFRVFFQGNQFLKFGPQGSPFG 366 G+W +LS FF+ FF +KFG + P G Sbjct: 395 GMWMWLSCSSFFQQFFHCYCPVKFGRKADPNG 426 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 9.0 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 483 GSEGGHPVFGPLGFSFQIFPGFFPRKPIFKIRTPRFPLWKGQV-FP 349 G G P P G I P F P P+ +R P FPL Q+ FP Sbjct: 526 GPLGPPPPPPPGGAVLNIPPQFLP-PPLNLLRAPFFPLNPAQLRFP 570 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,010,552 Number of Sequences: 2352 Number of extensions: 20168 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 120863106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -