BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C15 (928 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 29 0.70 SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosacchar... 26 6.6 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 29.5 bits (63), Expect = 0.70 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 108 PLQWFERNFPEVQQPQNSLKEI 43 P QW ER+FP Q NS +EI Sbjct: 246 PFQWIERSFPSQVQLANSRREI 267 >SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 26.2 bits (55), Expect = 6.6 Identities = 20/62 (32%), Positives = 25/62 (40%) Frame = +3 Query: 288 PYPPARPCLRTSREIAKEYNIEKSCDKYMNVDVVKQFMEMYKMGMLPRGETFVHTNELQM 467 PYP C AK I +SC KYMN D V Q +M P G+ + + Sbjct: 120 PYPEEYSC-------AKNLYICESCLKYMNSDHVLQRHKMKCSWSYPPGDEIYRDKNISI 172 Query: 468 EE 473 E Sbjct: 173 FE 174 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,207,070 Number of Sequences: 5004 Number of extensions: 57997 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 469338710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -