BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C12 (909 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L16560-5|AAA27996.1| 443|Caenorhabditis elegans Hypothetical pr... 28 8.0 AF040657-4|AAB95053.1| 261|Caenorhabditis elegans Hypothetical ... 28 8.0 >L16560-5|AAA27996.1| 443|Caenorhabditis elegans Hypothetical protein D2007.5 protein. Length = 443 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 117 LGHSQQSEDXNHEEXHSLYDHELSPNLKD 31 LG S SED H + + Y+ + P+L D Sbjct: 261 LGQSTSSEDSRHSDVQNSYEEDHKPSLAD 289 >AF040657-4|AAB95053.1| 261|Caenorhabditis elegans Hypothetical protein T20H9.4 protein. Length = 261 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -2 Query: 116 LAIASRARTXIMKNXILYMITSYHQILRIPYSEVGK 9 LAI SR +T ++KN L+++ Q RI + E K Sbjct: 128 LAILSRCKTKVLKNIDLFIVYRSEQFERITHLEQWK 163 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,916,705 Number of Sequences: 27780 Number of extensions: 237993 Number of successful extensions: 496 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 496 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -