BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C08 (1253 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 34 0.047 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 28 2.4 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 33.9 bits (74), Expect = 0.047 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +3 Query: 612 NPVXXTAXHPPGXHPTXRXXXPTXXPLPXPXLHPXPPPXXXTLALTHPAXP 764 +P+ A + P P PT P P HP PPP +++ + P P Sbjct: 711 SPMGTGAVNSPAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 28.3 bits (60), Expect = 2.4 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +3 Query: 564 APPXPXLSXVXXRWXANPVXXTAXHPPGXHPTXRXXXPTXXPLPXPXLHPXPP--PXXXT 737 AP P L R PV PP P+ P P+ P P PP P Sbjct: 400 APALPPLGNAS-RTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPP 458 Query: 738 LALTHPAXP 764 L PA P Sbjct: 459 LPAGMPAAP 467 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,089,347 Number of Sequences: 5004 Number of extensions: 18490 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 2,362,478 effective HSP length: 75 effective length of database: 1,987,178 effective search space used: 679614876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -