BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C07 (858 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 1.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 1.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 1.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 1.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 1.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.4 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 106 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 153 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 14 SASPLGPPFXLCAXLSYFSPCAHSCSSQNAILHAFRPRSAGSGQRSSP 157 S SP G P A + SP + + S+ + ++ SGQ S+P Sbjct: 150 STSPPGKPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKSGQSSNP 197 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +3 Query: 282 PKITTLMETATNLSTTVHITWTLPKADLTSSLPLS 386 P++TT ++T + + +H WT + SS S Sbjct: 1015 PQVTTGVDTGASSTEHMHPDWTTKPSTWWSSTTTS 1049 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,339 Number of Sequences: 336 Number of extensions: 2661 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -