BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C07 (858 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 29 0.64 SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 28 1.5 SPCP1E11.02 |ppk38||Ark1/Prk1 family protein kinase Ppk38|Schizo... 27 2.6 SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|... 27 4.5 SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizo... 27 4.5 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 29.5 bits (63), Expect = 0.64 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 427 NFLRYSLLPTASTRERGRLEVRSALGRVHVICTVVDRFV 311 NF ++P STR+R + +R G +H+IC D + Sbjct: 756 NFRVLDIIPFTSTRKRMSVIIRDEDGIIHLICKGADTVI 794 >SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +2 Query: 287 DYNPNG-NGYEPIDNGAYYVDPPQG---RPYFKPTPFPG 391 DYN N N Y PI N Y+++ G PYF PG Sbjct: 119 DYNNNRKNFYPPIQNSTYFINATGGIDSMPYFGLNNAPG 157 >SPCP1E11.02 |ppk38||Ark1/Prk1 family protein kinase Ppk38|Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 27.5 bits (58), Expect = 2.6 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 194 SMXPNPFFAQPTVGNGYEP-IDNRPYIVNPPKDYNPNGNGYEPIDNGAY 337 S+ P P A + + P +++ PY+ N D+N NGN P+ +Y Sbjct: 350 SVFPQPASAMKPMASPMLPNVNSMPYLSNG--DHNNNGNTSSPVSRFSY 396 >SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 278 Score = 26.6 bits (56), Expect = 4.5 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 281 PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPT 379 PK PN N +P NG + PP Y KPT Sbjct: 46 PKASKPNSN--QPYPNGPVCIYPPNIYLYAKPT 76 >SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1401 Score = 26.6 bits (56), Expect = 4.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 313 RTYRQRCILRGPSPRPTLLQAYPFPWCSRWEVKNIL 420 R + ++C R P RP + PW + + K I+ Sbjct: 1280 RDFIEQCFERDPEQRPRAVDLLTHPWITDFRKKTII 1315 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,389,011 Number of Sequences: 5004 Number of extensions: 43262 Number of successful extensions: 113 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -