BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C07 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 26 1.7 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 25 3.9 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 24 5.1 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.0 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 9.0 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 268 HR*SSQRLQP*WKRLRTYRQRCILRGPSPRPTLLQA 375 +R ++++ WKR+RT R + + P P+L+ A Sbjct: 54 YRTCNRQINQQWKRIRTERLKTLEHSPEMPPSLIIA 89 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.6 bits (51), Expect = 3.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 293 NPNGNGYEPIDNGAYYV 343 N NGNGY D+G Y V Sbjct: 269 NRNGNGYGAGDDGGYVV 285 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 24.2 bits (50), Expect = 5.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 650 LSQLIXVXYHVWIPXTLXXGRSXAPXP 570 +S+ I V + +W+P L R P P Sbjct: 311 MSEWIRVVFLIWLPFILRMSRPGEPYP 337 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 9.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 343 GPSPRPTLLQAYPFP 387 GP P PTL Q P P Sbjct: 71 GPQPDPTLEQGVPVP 85 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.4 bits (48), Expect = 9.0 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +2 Query: 254 DNRPYIVNPPKDY------NPNGNGYEPIDNGAYYVDPP 352 D PY NP +DY NPN Y P D +PP Sbjct: 183 DRTPY--NPSRDYDDRNRYNPNARPYNPNDPSFGGRNPP 219 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,252 Number of Sequences: 2352 Number of extensions: 11296 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -