BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C05 (999 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 36 0.067 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.36 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 33 0.47 07_03_0890 - 22332768-22333382 33 0.47 12_02_1174 - 26696869-26698191 32 0.82 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 32 0.82 02_05_0686 - 30900748-30902167,30903442-30904742 32 0.82 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.4 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 1.4 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 31 1.4 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 31 1.4 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.4 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.4 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.9 05_03_0039 - 7621613-7622695 31 1.9 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 31 1.9 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 31 1.9 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 31 1.9 01_01_1134 + 8994315-8995892 31 1.9 11_04_0382 - 17001848-17002237 30 2.5 05_04_0337 - 20372378-20373094,20373320-20373379,20373992-203742... 30 2.5 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 30 2.5 02_04_0021 + 18975992-18976408 30 2.5 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 30 3.3 04_04_1542 - 34264994-34265331,34266195-34267029 30 3.3 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 30 3.3 03_06_0599 + 34984869-34985319,34986581-34987563 30 3.3 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 3.3 08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270,438... 29 4.4 06_03_0447 + 20878444-20878821 29 4.4 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 4.4 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 29 4.4 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.4 01_01_0715 - 5542648-5543219,5543352-5543544 29 4.4 07_03_0089 - 13300902-13301645 29 5.8 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 5.8 03_02_0657 + 10225503-10226114,10226563-10226879,10226977-102270... 29 5.8 01_02_0007 + 10132380-10133201 29 5.8 12_01_0981 + 9931542-9931606,9931779-9933105 29 7.7 08_01_0059 - 394001-394708 29 7.7 07_01_0862 - 7172083-7172931 29 7.7 07_01_0466 - 3518315-3521428 29 7.7 05_03_0030 + 7529814-7530257,7530409-7530462,7531605-7532793,753... 29 7.7 04_04_1413 - 33386049-33386339 29 7.7 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 29 7.7 02_01_0434 + 3158637-3159319,3159460-3159576,3160064-3160226,316... 29 7.7 01_01_0187 + 1624159-1624279,1624530-1624590,1625118-1625574 29 7.7 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 35.5 bits (78), Expect = 0.067 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 877 APXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFP 981 AP PPLP P P R PAP PPP T P Sbjct: 729 APAPPLPPPLPAAANKRNP-PAPPPPPLMTGKKAP 762 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPP 959 A + PPPPP P P + PPPP Sbjct: 560 AFSPPPPPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P P P PPP Sbjct: 565 PPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P G PPPP Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPP 715 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPP 959 A A PPPPP P P PPPP Sbjct: 541 AAAPPPPPPPPPPPSGNKPAFSPPPPPPPPP 571 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 880 PXPPLPXPXPXKKQXRXXGPAPXPPPXXTXH 972 P PP P P P R P P PPP H Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNH 630 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P +T G PPPP Sbjct: 690 PPPPPPPLPPANRTNGPGVPSAPPPPP 716 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P K P P PPP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFP 980 PPPPP P P PPPP + P Sbjct: 567 PPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVP 600 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFP 981 P+P PP P P P P P PPP P Sbjct: 600 PSPPPP-PPPPPILPNRSVPPPPPPPPPLPNHSVLP 634 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +1 Query: 757 PPXRXPRRPPXTK--KXXXHXXXXXXXXXXXXVX*XXTXXXPAPXPPLPXPXPXKKQXRX 930 PP R R PP T+ V P P PP P P P K Sbjct: 311 PPARSRRTPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTA 370 Query: 931 XGPAPXPPP 957 P P PPP Sbjct: 371 PKPPPPPPP 379 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P K P P PPP Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P P P PPP Sbjct: 354 PPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFPRXGGG 995 A A PPPPP P G PPPP PR G Sbjct: 610 ASALPPPPPRPPGAPPPPPPPGKPGGPPPPPPRPGSLPRNLAG 652 >07_03_0890 - 22332768-22333382 Length = 204 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPP 959 A A PPPPP P P + PPPP Sbjct: 80 AEATPPPPPPPPPPERAVPEAADTPPPPPPP 110 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P K R P P PPP Sbjct: 242 PKPQPPPPPPRAPVKMPRVLEPKPSPPP 269 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P + P P PPP Sbjct: 156 PPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P + G PPPP Sbjct: 251 PPPPPPPPGPPPREIVPGQTLLPPPPP 277 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P G PPPP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPP 256 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXG--GXRXXPPPPXXHXXFPR 983 A + PP PP P P K G G PPPP PR Sbjct: 223 AASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPPR 263 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFPG 984 P P PP P P + Q G P PPP +PG Sbjct: 404 PLPPPP-PGLPPAQMQMAPFGVPPGPPPMLPPPFYPG 439 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P P P PPP Sbjct: 228 PLPPPPPPPPKPANIAGAPGLPLPPPPP 255 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P GG + PPPP Sbjct: 355 PPPPPKGPSPPPPPPP-GGKKGGPPPP 380 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 231 PPP*XXGPXFIFXPXKXXLVLXKPXPPPXXXXPPFFWPPXXGGXKGG 371 PPP GP P P PPP PP PP GG KGG Sbjct: 337 PPPPPKGP-----PPPPPAKGPPPPPPPKGPSPPP--PPPPGGKKGG 376 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 867 AXAXPPP-PPSXPXPXKKTXXXGGXRXXPPPP 959 A + PPP PP P P GG PPPP Sbjct: 917 ALSPPPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFPRXGGG 995 A A PPPP P G PPPP PR G Sbjct: 915 ASALSPPPPRPPGAPPPPPPPGKPGGPPPPPPPPGSLPRNLAG 957 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P G PPPP Sbjct: 34 PPPPPLEPAPPSTPQLRGEASPPPPPP 60 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P + P P PPP Sbjct: 327 PPPAPPPPPPPPSRFNNTTPKPPPPPPP 354 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P P P P P R GPA PPP Sbjct: 76 PPPSMPGPLPAPYDHHHRGGGPAQPPPP 103 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXX----GGXRXXPPPP 959 PPPPPS P P GG PPPP Sbjct: 74 PPPPPSMPGPLPAPYDHHHRGGGPAQPPPPP 104 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P G PPPP Sbjct: 273 PPPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 873 AXPPPPPSXPX---PXKKTXXXGGXRXXPPPPXXHXXFPR 983 A PPPPP+ P P GG + PPPP PR Sbjct: 279 APPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPR 318 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPP-PXXTXHXFP 981 P P PP P P P P P PP P H P Sbjct: 66 PLPAPPTPSPVPEHLHHHPPPPPPVPPCPPNATHVVP 102 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P + AP PPP Sbjct: 267 PPPPPPPPPPMPPRTDNASTQAAPAPPP 294 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFPRXGGG 995 PPPPP P P + PPPP PR G G Sbjct: 269 PPPPPPPPMPPRTDNASTQAAPAPPPP-----LPRAGNG 302 >05_03_0039 - 7621613-7622695 Length = 360 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 874 PAPXP-PLPXPXPXKKQXRXXGPAPXPPPXXTXHXFP 981 P P P P P P P K GP P P P H P Sbjct: 144 PEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKPHPEP 180 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 886 PPLPXPXPXKKQXRXXGPAPXPP 954 PP P P P + R GP P PP Sbjct: 10 PPTPSPPPFSSRPRVVGPPPPPP 32 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P + GG PPP Sbjct: 11 PPPPPQHPPPPQAGGGGGGEFYRGPPP 37 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPP 954 P P PP P P P K + GP P PP Sbjct: 165 PKPSPPKPKPGPKPKPPK-PGPKPKPP 190 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P K + GP P P P Sbjct: 185 PKPKPPKPGPKPKPKPPK-PGPKPKPKP 211 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P PP P P P K + GP P P P Sbjct: 196 PKPKPPKPGPKPKPKPPK-PGPKPKPGP 222 >01_01_1134 + 8994315-8995892 Length = 525 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXF---PRXGGG 995 A A PPPPP P K G PPP + F P GGG Sbjct: 194 ANAPPPPPPCEEEPVKMKISPGSSTF--PPPLANSIFAAAPNRGGG 237 >11_04_0382 - 17001848-17002237 Length = 129 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 992 PPXPGKXXMVXXGGGXGAGPXXRXCFFXGXGXGRGGXGA 876 P P + GGG G G C G G G GG A Sbjct: 39 PAAPARVCDGCSGGGGGHGSRSERCLVCGAGAGEGGAAA 77 >05_04_0337 - 20372378-20373094,20373320-20373379,20373992-20374266, 20374358-20374619 Length = 437 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPPP 959 A A PPPPPS P PPPP Sbjct: 285 AAAAPPPPPSLPASATTRNSNASQLLMPPPP 315 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 877 APXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFPGXGGG 996 AP PP P P P P P PP PG G G Sbjct: 330 APAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPG 369 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 880 PXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFPGXGGG 996 P PP P P + GP P PPP G GGG Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPPGAA-----GRGGG 382 >02_04_0021 + 18975992-18976408 Length = 138 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPP 957 P P P P P P + P+P PPP Sbjct: 97 PPPPKPKPTPPPPAPTPKPPAPSPSPPP 124 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 862 TXXXPAPXPPLPXPXPXKKQXRXXGPAPXPP 954 T P P PP P P P ++ R P P PP Sbjct: 66 TVTTPTPPPPPPAPRPPRRHHRI--PPPPPP 94 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +3 Query: 879 PPPPPSXPXP--XKKTXXXGGXRXXPPPP 959 PPPPPS P P ++ G PPPP Sbjct: 228 PPPPPSPPKPLVAQQQHHHHGHHHHPPPP 256 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFPRXGGG 995 PP PP P P GG PPPP P GG Sbjct: 1198 PPTPPGAPAPPMPPGVPGG----PPPPPGGRGLPAPPGG 1232 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 880 PXPPLPXPXPXKKQXRXXGPAPXPPP 957 P PP P P P + P+P PPP Sbjct: 399 PPPPQPPPPPPPPPHQRETPSPSPPP 424 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFP 981 P P PP P P P + P P PP T FP Sbjct: 364 PPPPPPPPRPPPPPPPIKKGAP-PPAPPKATMARFP 398 >08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270, 4381944-4382047,4382127-4382259,4384477-4384653, 4385164-4385309,4385536-4385625,4385703-4385915, 4386090-4386182,4386743-4386937,4387018-4387110, 4387924-4388019,4388556-4388985,4389424-4390091, 4392074-4392271,4392690-4393407,4394036-4394181 Length = 1628 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 877 APXPPLPXPXPXKKQXRXXGPAPXPPP 957 A PPLP P P ++ R G +P PPP Sbjct: 2 AVAPPLP-PAPARQLRRWKGSSPRPPP 27 >06_03_0447 + 20878444-20878821 Length = 125 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 877 APXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFPGXGGG 996 AP PP P P P + R P P P P T P GGG Sbjct: 47 APPPPRPIP-PDLVEGRALAPPPPPLPLTTLP--PDSGGG 83 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 4/32 (12%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXG----PAPXPPP 957 P P PP P P KQ G PAP PPP Sbjct: 398 PPPTPPPPPPLLAPKQQSSGGPILPPAPAPPP 429 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXX----GPAPXPPPXXT 966 P P PP P P P Q + GPA PPP T Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPT 401 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 867 AXAXPPPPPSXPXPXKKTXXXGGXRXXPPP 956 A PPPPP P P + T PPP Sbjct: 426 AFEQPPPPPEHPPPPESTSPPPPPTSDPPP 455 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXG----GXRXXPPPPXXH 968 PPPPP P P K G + PPPP H Sbjct: 126 PPPPPPPPPPFKGDHYGGVYQNWQQNGPPPPPDH 159 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 877 APXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFPGXGGG 996 AP PP+P P P P P PPP P GG Sbjct: 174 APSPPVPAPAPAGSP-----PPPPPPPAGGNFTAPSPAGG 208 >07_03_0089 - 13300902-13301645 Length = 247 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PAPXP-PLPXPXPXKKQXRXXGPAPXPPP 957 P+P P P P P P KQ P P P P Sbjct: 74 PSPQPDPKPTPQPEPKQDPKPNPQPDPKP 102 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PAPXP-PLPXPXPXKKQXRXXGPAPXPPP 957 P+P P P P P P KQ P P P P Sbjct: 102 PSPQPDPKPTPQPDPKQDPQPNPQPDPKP 130 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P + R PPPP Sbjct: 357 PPPPPPPPPPVYYSSYVMLDRPPPPPP 383 >03_02_0657 + 10225503-10226114,10226563-10226879,10226977-10227088, 10227292-10227423,10227519-10227593 Length = 415 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPP P+ P GG PPPP Sbjct: 114 PPPSPTYTQPIVNARKEGGMAPPPPPP 140 >01_02_0007 + 10132380-10133201 Length = 273 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 874 PAPXP-PLPXPXPXKKQXRXXGPAPXPPP 957 P P P PLP P P + GP P P P Sbjct: 80 PQPQPQPLPQPQPQPQPLPLPGPQPLPQP 108 >12_01_0981 + 9931542-9931606,9931779-9933105 Length = 463 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPPXXHXXFP 980 PPPP P + T PPPP H P Sbjct: 49 PPPPNHIPTTERNTSVFFNTSTIPPPPPPHFPQP 82 >08_01_0059 - 394001-394708 Length = 235 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPP + P P ++ PPPP Sbjct: 11 PPPPATPPPPPRRAPPPPSPPIRPPPP 37 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +1 Query: 874 PAPXPPLPXPXPXKKQXRXXGPAPXPPPXXTXHXFP 981 PAP PP P P P ++ + P PP FP Sbjct: 125 PAPPPPPPPPPPTAEEKKLLLFPPPLPPRKKAMLFP 160 >07_01_0466 - 3518315-3521428 Length = 1037 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 880 PXPPLPXPXPXKKQXRXXGPAPXPPP 957 P PP P P P +Q P PPP Sbjct: 242 PPPPTPTPTPMLRQVPVPARPPPPPP 267 >05_03_0030 + 7529814-7530257,7530409-7530462,7531605-7532793, 7532861-7533522 Length = 782 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 882 PPPPSXPXPXKKTXXXGGXRXXPPPP 959 PP PS P +T GG PPPP Sbjct: 400 PPLPSVPVTDPETYGWGGNFFAPPPP 425 >04_04_1413 - 33386049-33386339 Length = 96 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 956 GGGXGAGPXXRXCFFXGXGXGRGGXGAG 873 GGG G G C G G G GG G G Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGGGGCGGG 89 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 880 PXPPLPXPXPXKKQXRXXGPAPXP 951 P PPLP P P Q R P P P Sbjct: 31 PPPPLPPPPPGPLQRRSSLPPPPP 54 >02_01_0434 + 3158637-3159319,3159460-3159576,3160064-3160226, 3160394-3160600 Length = 389 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 879 PPPPPSXPXPXKKTXXXGGXRXXPPPP 959 PPPPP P P + G PPP Sbjct: 24 PPPPPPPPMPAYQYHATGACAAAAPPP 50 >01_01_0187 + 1624159-1624279,1624530-1624590,1625118-1625574 Length = 212 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 954 GGGXXGXXPPXLFFXGXGXRKGGXGG 877 GGG PP + G G R GG GG Sbjct: 66 GGGGAAAPPPTMQMGGGGFRGGGVGG 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,112,484 Number of Sequences: 37544 Number of extensions: 491531 Number of successful extensions: 5733 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4684 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2928685000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -