BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C04 (910 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 26 0.47 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 26 0.47 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 26 0.47 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 7.6 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 7.6 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 25.8 bits (54), Expect = 0.47 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +1 Query: 67 RNWVSKMNAATPSHLCWWDLSVAASKVANGS 159 R+++ ++ + SHLC W + + + V+NG+ Sbjct: 197 RSYIPPLSTSMRSHLCNWGSANSTNIVSNGN 227 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.8 bits (54), Expect = 0.47 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +1 Query: 67 RNWVSKMNAATPSHLCWWDLSVAASKVANGS 159 R+++ ++ + SHLC W + + + V+NG+ Sbjct: 357 RSYIPPLSTSMRSHLCNWGSANSTNIVSNGN 387 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.8 bits (54), Expect = 0.47 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +1 Query: 67 RNWVSKMNAATPSHLCWWDLSVAASKVANGS 159 R+++ ++ + SHLC W + + + V+NG+ Sbjct: 357 RSYIPPLSTSMRSHLCNWGSANSTNIVSNGN 387 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 209 RLDPQSNIAPTLRCLKTEPLA 147 +LD +++ +P LR L T P A Sbjct: 115 KLDKKNDDSPALRALLTRPQA 135 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.8 bits (44), Expect = 7.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 209 RLDPQSNIAPTLRCLKTEPLA 147 +LD +++ +P LR L T P A Sbjct: 115 KLDKKNDDSPALRALLTRPQA 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,634 Number of Sequences: 336 Number of extensions: 3261 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25341085 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -