BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C04 (910 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100655-10|ABO16451.1| 246|Caenorhabditis elegans Hypothetical... 28 8.0 AF100655-8|ABO16452.1| 470|Caenorhabditis elegans Hypothetical ... 28 8.0 AF100655-6|ABO16453.1| 470|Caenorhabditis elegans Hypothetical ... 28 8.0 AF100655-4|ABO16447.1| 470|Caenorhabditis elegans Hypothetical ... 28 8.0 AF045643-2|AAC02596.2| 663|Caenorhabditis elegans Hypothetical ... 28 8.0 >AF100655-10|ABO16451.1| 246|Caenorhabditis elegans Hypothetical protein C44C8.7 protein. Length = 246 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 641 HYVTLDIEVXKVKXTMEKXDFNLKIDYVRLLKSSAIEDDALFLLVNN 781 +YVT++ + ++ K DF ID +S IE D +L++N Sbjct: 76 YYVTVNQDTYQLNVANRKKDFQFDIDPTNHPDASEIEQDPNEILIDN 122 >AF100655-8|ABO16452.1| 470|Caenorhabditis elegans Hypothetical protein C44C8.8 protein. Length = 470 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 641 HYVTLDIEVXKVKXTMEKXDFNLKIDYVRLLKSSAIEDDALFLLVNN 781 +YVT++ + ++ K DF ID +S IE D +L++N Sbjct: 76 YYVTVNQDTYQLNVANRKKDFQFDIDPTNHPDASEIEQDPNEILIDN 122 >AF100655-6|ABO16453.1| 470|Caenorhabditis elegans Hypothetical protein C44C8.9 protein. Length = 470 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 641 HYVTLDIEVXKVKXTMEKXDFNLKIDYVRLLKSSAIEDDALFLLVNN 781 +YVT++ + ++ K DF ID +S IE D +L++N Sbjct: 76 YYVTVNQDTYQLNVANRKKDFQFDIDPTNHPDASEIEQDPNEILIDN 122 >AF100655-4|ABO16447.1| 470|Caenorhabditis elegans Hypothetical protein C44C8.10 protein. Length = 470 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 641 HYVTLDIEVXKVKXTMEKXDFNLKIDYVRLLKSSAIEDDALFLLVNN 781 +YVT++ + ++ K DF ID +S IE D +L++N Sbjct: 76 YYVTVNQDTYQLNVANRKKDFQFDIDPTNHPDASEIEQDPNEILIDN 122 >AF045643-2|AAC02596.2| 663|Caenorhabditis elegans Hypothetical protein F58H7.7 protein. Length = 663 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 641 HYVTLDIEVXKVKXTMEKXDFNLKIDYVRLLKSSAIEDDALFLLVNN 781 +YVT++ + ++ K DF ID +S IE D +L++N Sbjct: 76 YYVTVNQDTYQLNVANRKKDFQFDIDPTNHPDASEIEQDPNEILIDN 122 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,127,907 Number of Sequences: 27780 Number of extensions: 306045 Number of successful extensions: 689 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -