BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_C04 (910 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-g... 28 7.4 At1g68890.1 68414.m07884 menaquinone biosynthesis protein-relate... 28 9.8 >At1g69830.1 68414.m08034 alpha-amylase, putative / 1,4-alpha-D-glucan glucanohydrolase, putative similar to SP|P17859 Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) {Vigna mungo}, alpha-amylase [Malus x domestica] GI:7532799; contains Pfam profile PF00128: Alpha amylase, catalytic domain Length = 887 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 113 VGGT*ASQLPKLLTAQFLDSAALELYSTEDQVVGA-FVISNAEKSEGKIY 259 VG + ++ P + A D+A +E ++D + F + EK+EGKIY Sbjct: 52 VGVSSMNKSPVAIRATSSDTAVVETAQSDDVIFKEIFPVQRIEKAEGKIY 101 >At1g68890.1 68414.m07884 menaquinone biosynthesis protein-related similar to menaquinone biosynthesis protein menD [SP|P17109][E. coli] ; Pfam HMM hit: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase / 2-oxoglutarate decarboxylase Length = 894 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 264 YTLTLTIIELEKGVYEVRFKF*PHSSNYWAK 356 YT+ TI EK +++V F P+ ++W K Sbjct: 254 YTVEQTISSYEKSIFQVSSHFCPNVEDHWFK 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,175,620 Number of Sequences: 28952 Number of extensions: 288272 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -