BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B23 (838 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.3 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 6.9 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 496 WAWHIHGLLYSFTGLNLFIY 555 W +H H L + G+NL I+ Sbjct: 667 WLFHCHFLFHIVIGMNLIIH 686 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 456 LGRIK-LCTALSQSLGLAYTWIIIFIYWLKSL 548 LGR K L + +A+ W +IF +W+ L Sbjct: 113 LGREKQFIVKLPSAERVAWMWCLIFAFWVPQL 144 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 456 LGRIK-LCTALSQSLGLAYTWIIIFIYWLKSL 548 LGR K L + +A+ W +IF +W+ L Sbjct: 113 LGREKQFIVKLPSAERVAWMWCLIFAFWVPQL 144 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 456 LGRIK-LCTALSQSLGLAYTWIIIFIYWLKSL 548 LGR K L + +A+ W +IF +W+ L Sbjct: 113 LGREKQFIVKLPSAERVAWMWCLIFAFWVPQL 144 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 2.3 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 456 LGRIK-LCTALSQSLGLAYTWIIIFIYWLKSL 548 LGR K L + +A+ W +IF +W+ L Sbjct: 113 LGREKQFIVKLPSAERVAWMWCLIFAFWVPQL 144 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 496 WAWHIHGLLYSFTGLNLFI 552 W +H H L + G+NL + Sbjct: 667 WLFHCHFLFHIVIGMNLVL 685 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,816 Number of Sequences: 336 Number of extensions: 3090 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -