BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B23 (838 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 2.9 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 24 6.6 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 24 6.6 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 24 6.6 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 24 6.6 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 208 DDVSKIIKEAIENSIGGTAYQHKQCQPNGTSXSC*VMSG 324 D + K N++GGT Y K+C P + +C M+G Sbjct: 752 DTCDQCAKGYYGNALGGTPYDCKRC-PCPNNGACMQMAG 789 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 23.8 bits (49), Expect = 6.6 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 441 LVHGPLGRIKLCTALSQSLGLAYTWIIIFIYWLKSL 548 L H P + +GL Y WI + I LK L Sbjct: 122 LRHDPFALLPFSAGSRNCVGLRYAWISMKIMLLKVL 157 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.8 bits (49), Expect = 6.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 430 CYXNNKKNCMQSCTILLQY 374 CY + +C CT++ +Y Sbjct: 254 CYQRLRSDCQDECTLIARY 272 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.8 bits (49), Expect = 6.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 430 CYXNNKKNCMQSCTILLQY 374 CY + +C CT++ +Y Sbjct: 238 CYQRLRSDCQDECTLIARY 256 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.8 bits (49), Expect = 6.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 430 CYXNNKKNCMQSCTILLQY 374 CY + +C CT++ +Y Sbjct: 254 CYQRLRSDCQDECTLIARY 272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,263 Number of Sequences: 2352 Number of extensions: 12860 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -