BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP05_F_B22 (1078 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1509 - 27246721-27247350 29 4.8 11_06_0610 - 25449085-25453284 29 6.4 05_06_0005 + 24802843-24803101,24804086-24804333,24804417-248045... 29 8.4 >07_03_1509 - 27246721-27247350 Length = 209 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 415 PLVIPTFYPKSPLVGSLPKVPXDLSLPPIFPCSP 314 P IP P SP++GSLP L P + SP Sbjct: 20 PATIPVAVPPSPVLGSLPSAIKCNPLAPFYRFSP 53 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 29.1 bits (62), Expect = 6.4 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Frame = -1 Query: 535 APVLXDPPXTGNFGLQVPKYSGXRKACPGQFXRDSSFEETP-LVIPTFYPKSPLVGSLPK 359 APV+ +PP T + QVP S A S ETP P P+ S+PK Sbjct: 1051 APVISEPPPTKSSPPQVPVTSEPPPAKSSPPHEPISPPETPEKSYPPSTPEESSPPSVPK 1110 Query: 358 V---PXDLSLPP 332 P + SLPP Sbjct: 1111 ASSPPTEKSLPP 1122 >05_06_0005 + 24802843-24803101,24804086-24804333,24804417-24804572, 24804956-24805114,24805862-24805929,24806044-24806433, 24806515-24806563,24806636-24806788,24807416-24807589, 24808207-24808362,24808705-24808756,24808830-24808988, 24809058-24809094,24809218-24809252,24809349-24809400, 24809614-24809663,24810590-24811924,24812688-24812825, 24812907-24812957,24813081-24814237 Length = 1625 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 314 WGTGENGGEGKVXRDFGERXDQGTFWVKGG 403 +G G G G+ DFG R DQG+ W G Sbjct: 1042 FGRGRGRGRGRESGDFGGRNDQGS-WKNSG 1070 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,376,683 Number of Sequences: 37544 Number of extensions: 381112 Number of successful extensions: 736 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 736 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3211228900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -